Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1JGD9

Protein Details
Accession A0A2N1JGD9    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
80-101NTSCYRPRRAGQRRRKSVRGCIHydrophilic
181-211QRLITPQRLQRKRDEKRVKHLRYAKRTAEKAHydrophilic
NLS Segment(s)
PositionSequence
87-95RRAGQRRRK
162-206RTIEPKKEGAKPYTKAPRIQRLITPQRLQRKRDEKRVKHLRYAKR
Subcellular Location(s) nucl 13, cyto_nucl 11.833, cyto 9.5, mito_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLNVANPATGAQKSFEFLDERNVRCFFDKRMAQDVEVDSLGDEWKGYVLRIGGGNDKQGFPMKQGVLLPYRVRLLLGANTSCYRPRRAGQRRRKSVRGCIVGPDIQALHCSIVKQGEQEIPGLTNPESAVPKRLGPKRANHIRKFFNLTKEDDVRKYVIRRTIEPKKEGAKPYTKAPRIQRLITPQRLQRKRDEKRVKHLRYAKRTAEKAAYDELITKRLGERKTQTAATTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.17
5 0.17
6 0.27
7 0.32
8 0.33
9 0.37
10 0.37
11 0.36
12 0.38
13 0.41
14 0.34
15 0.37
16 0.4
17 0.39
18 0.46
19 0.46
20 0.42
21 0.44
22 0.41
23 0.34
24 0.3
25 0.25
26 0.16
27 0.15
28 0.14
29 0.09
30 0.08
31 0.05
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.11
39 0.13
40 0.17
41 0.17
42 0.22
43 0.22
44 0.22
45 0.22
46 0.25
47 0.23
48 0.2
49 0.26
50 0.21
51 0.22
52 0.23
53 0.25
54 0.23
55 0.26
56 0.24
57 0.2
58 0.21
59 0.18
60 0.17
61 0.14
62 0.14
63 0.13
64 0.16
65 0.14
66 0.15
67 0.16
68 0.17
69 0.21
70 0.22
71 0.21
72 0.22
73 0.26
74 0.35
75 0.45
76 0.55
77 0.62
78 0.71
79 0.78
80 0.82
81 0.86
82 0.8
83 0.79
84 0.77
85 0.71
86 0.61
87 0.53
88 0.49
89 0.41
90 0.36
91 0.27
92 0.18
93 0.13
94 0.12
95 0.1
96 0.07
97 0.07
98 0.07
99 0.07
100 0.08
101 0.08
102 0.08
103 0.1
104 0.11
105 0.11
106 0.11
107 0.11
108 0.09
109 0.09
110 0.1
111 0.09
112 0.07
113 0.07
114 0.09
115 0.1
116 0.1
117 0.13
118 0.13
119 0.16
120 0.23
121 0.28
122 0.33
123 0.36
124 0.42
125 0.5
126 0.6
127 0.66
128 0.65
129 0.67
130 0.65
131 0.65
132 0.66
133 0.6
134 0.57
135 0.5
136 0.48
137 0.46
138 0.47
139 0.46
140 0.4
141 0.38
142 0.32
143 0.33
144 0.32
145 0.31
146 0.32
147 0.31
148 0.35
149 0.41
150 0.49
151 0.52
152 0.52
153 0.52
154 0.52
155 0.56
156 0.56
157 0.54
158 0.52
159 0.48
160 0.54
161 0.6
162 0.58
163 0.58
164 0.61
165 0.64
166 0.62
167 0.63
168 0.59
169 0.59
170 0.65
171 0.66
172 0.64
173 0.61
174 0.66
175 0.71
176 0.69
177 0.69
178 0.7
179 0.71
180 0.76
181 0.81
182 0.78
183 0.82
184 0.89
185 0.85
186 0.84
187 0.85
188 0.84
189 0.83
190 0.84
191 0.82
192 0.81
193 0.77
194 0.73
195 0.7
196 0.62
197 0.55
198 0.5
199 0.42
200 0.33
201 0.36
202 0.31
203 0.27
204 0.25
205 0.23
206 0.24
207 0.29
208 0.31
209 0.33
210 0.38
211 0.43
212 0.49
213 0.51