Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1JHL3

Protein Details
Accession A0A2N1JHL3   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-37SMGKRHTKTHTICRRCNRRSFHRQHKTCSACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MTKGTSSMGKRHTKTHTICRRCNRRSFHRQHKTCSACGYPSAKTRNYQWGQKAIRRKTTGSGRMRYLKTVPRRAKNGFRTGTASKAVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.69
4 0.68
5 0.75
6 0.79
7 0.83
8 0.81
9 0.83
10 0.81
11 0.8
12 0.82
13 0.84
14 0.85
15 0.85
16 0.82
17 0.81
18 0.82
19 0.76
20 0.67
21 0.6
22 0.51
23 0.4
24 0.39
25 0.35
26 0.27
27 0.29
28 0.31
29 0.28
30 0.28
31 0.3
32 0.36
33 0.36
34 0.39
35 0.36
36 0.41
37 0.44
38 0.48
39 0.54
40 0.5
41 0.55
42 0.53
43 0.51
44 0.5
45 0.55
46 0.59
47 0.57
48 0.56
49 0.54
50 0.59
51 0.59
52 0.55
53 0.5
54 0.49
55 0.51
56 0.57
57 0.61
58 0.61
59 0.67
60 0.71
61 0.76
62 0.77
63 0.77
64 0.7
65 0.64
66 0.62
67 0.57
68 0.54
69 0.47