Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NWD2

Protein Details
Accession J3NWD2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSAHHHHRTTNKRVWKRGFRDQGLHydrophilic
NLS Segment(s)
PositionSequence
41-53RNTAGKKVKGKKK
Subcellular Location(s) nucl 14.5, mito_nucl 12, mito 8.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSAHHHHRTTNKRVWKRGFRDQGLGKNEEDDIGANKKNNERNTAGKKVKGKKKQYMSDAQSIQITVFRVPWQLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.81
4 0.83
5 0.83
6 0.76
7 0.75
8 0.71
9 0.69
10 0.64
11 0.58
12 0.47
13 0.38
14 0.35
15 0.26
16 0.21
17 0.13
18 0.11
19 0.12
20 0.13
21 0.13
22 0.15
23 0.2
24 0.25
25 0.27
26 0.29
27 0.29
28 0.37
29 0.43
30 0.51
31 0.49
32 0.49
33 0.56
34 0.61
35 0.67
36 0.68
37 0.7
38 0.7
39 0.77
40 0.8
41 0.79
42 0.79
43 0.75
44 0.74
45 0.66
46 0.58
47 0.49
48 0.41
49 0.34
50 0.26
51 0.21
52 0.14
53 0.14
54 0.14