Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1JEV0

Protein Details
Accession A0A2N1JEV0   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-132LMPKVEKPSRKLRKERKNRAKKVRGTKKTADKKKBasic
NLS Segment(s)
PositionSequence
102-132KVEKPSRKLRKERKNRAKKVRGTKKTADKKK
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MPQDLNSPITIRTRKFITNRLLQRKQMALEVIHPQRPNCSRAELQEKIGEMYKAPKDQVFVFGLRTQFGGGRSKGFALIYDTPESTKLECAFRLVRNGLMPKVEKPSRKLRKERKNRAKKVRGTKKTADKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.5
4 0.5
5 0.54
6 0.63
7 0.69
8 0.71
9 0.67
10 0.67
11 0.63
12 0.56
13 0.49
14 0.41
15 0.32
16 0.29
17 0.34
18 0.32
19 0.33
20 0.33
21 0.3
22 0.35
23 0.38
24 0.36
25 0.3
26 0.31
27 0.29
28 0.34
29 0.42
30 0.36
31 0.35
32 0.35
33 0.34
34 0.29
35 0.29
36 0.22
37 0.14
38 0.18
39 0.18
40 0.17
41 0.18
42 0.17
43 0.17
44 0.18
45 0.21
46 0.17
47 0.15
48 0.15
49 0.17
50 0.16
51 0.15
52 0.15
53 0.11
54 0.11
55 0.12
56 0.14
57 0.12
58 0.13
59 0.14
60 0.14
61 0.14
62 0.13
63 0.12
64 0.12
65 0.14
66 0.15
67 0.16
68 0.16
69 0.16
70 0.17
71 0.18
72 0.13
73 0.14
74 0.14
75 0.14
76 0.14
77 0.18
78 0.2
79 0.21
80 0.26
81 0.24
82 0.23
83 0.26
84 0.28
85 0.26
86 0.26
87 0.26
88 0.24
89 0.32
90 0.36
91 0.36
92 0.39
93 0.49
94 0.55
95 0.64
96 0.72
97 0.74
98 0.8
99 0.87
100 0.93
101 0.93
102 0.94
103 0.95
104 0.95
105 0.95
106 0.94
107 0.94
108 0.93
109 0.92
110 0.89
111 0.88
112 0.88