Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PLD0

Protein Details
Accession J3PLD0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-50RDEWARRHPPPPRRAQPRRSNSPRYIVHydrophilic
147-169TSSGSSRQRRQQQQEQQRPRPGAHydrophilic
NLS Segment(s)
PositionSequence
29-42RRHPPPPRRAQPRR
Subcellular Location(s) mito 18, extr 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MKPSLRRGPPYMEAVIPRPLLAARDEWARRHPPPPRRAQPRRSNSPRYIVIDDDEDHRPPPSNYRDRSQQQAQPQPQQRATAWSFRPWAGDCFDLYEGSPYGLGSFRRRSGRDQQPPPRTPGAGPGSGQQGSEHARRGGGPPPSDATSSGSSRQRRQQQQEQQRPRPGAGGAFEGVDDYPLCKPKPGEYSVGTMVLLGTLRTQFDLPPAQRQAVVASFDVRGHLSFRVKTQNVYGVHIRDAMSPTTICSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.34
4 0.29
5 0.24
6 0.22
7 0.2
8 0.19
9 0.17
10 0.14
11 0.23
12 0.26
13 0.28
14 0.34
15 0.4
16 0.41
17 0.48
18 0.55
19 0.56
20 0.63
21 0.71
22 0.75
23 0.79
24 0.86
25 0.88
26 0.9
27 0.9
28 0.91
29 0.89
30 0.88
31 0.82
32 0.8
33 0.75
34 0.7
35 0.63
36 0.53
37 0.45
38 0.39
39 0.34
40 0.3
41 0.27
42 0.22
43 0.2
44 0.19
45 0.2
46 0.18
47 0.25
48 0.31
49 0.38
50 0.4
51 0.45
52 0.54
53 0.55
54 0.62
55 0.6
56 0.56
57 0.56
58 0.62
59 0.62
60 0.62
61 0.66
62 0.65
63 0.6
64 0.58
65 0.49
66 0.46
67 0.43
68 0.42
69 0.36
70 0.34
71 0.34
72 0.31
73 0.33
74 0.27
75 0.27
76 0.21
77 0.2
78 0.16
79 0.17
80 0.17
81 0.14
82 0.13
83 0.12
84 0.1
85 0.09
86 0.09
87 0.06
88 0.06
89 0.08
90 0.1
91 0.12
92 0.15
93 0.2
94 0.25
95 0.27
96 0.32
97 0.4
98 0.49
99 0.55
100 0.62
101 0.67
102 0.72
103 0.72
104 0.71
105 0.63
106 0.53
107 0.43
108 0.41
109 0.35
110 0.26
111 0.24
112 0.21
113 0.22
114 0.21
115 0.21
116 0.13
117 0.12
118 0.14
119 0.15
120 0.15
121 0.13
122 0.13
123 0.13
124 0.15
125 0.19
126 0.2
127 0.19
128 0.18
129 0.21
130 0.22
131 0.22
132 0.21
133 0.19
134 0.18
135 0.18
136 0.22
137 0.26
138 0.28
139 0.32
140 0.4
141 0.46
142 0.52
143 0.59
144 0.64
145 0.68
146 0.76
147 0.82
148 0.85
149 0.84
150 0.82
151 0.75
152 0.65
153 0.57
154 0.46
155 0.37
156 0.28
157 0.22
158 0.15
159 0.14
160 0.13
161 0.11
162 0.1
163 0.09
164 0.07
165 0.06
166 0.09
167 0.13
168 0.13
169 0.15
170 0.17
171 0.22
172 0.29
173 0.3
174 0.33
175 0.31
176 0.36
177 0.35
178 0.34
179 0.28
180 0.21
181 0.18
182 0.14
183 0.11
184 0.07
185 0.06
186 0.07
187 0.07
188 0.08
189 0.09
190 0.09
191 0.13
192 0.21
193 0.21
194 0.29
195 0.31
196 0.31
197 0.31
198 0.32
199 0.31
200 0.25
201 0.26
202 0.19
203 0.18
204 0.18
205 0.17
206 0.18
207 0.16
208 0.13
209 0.13
210 0.17
211 0.21
212 0.21
213 0.26
214 0.35
215 0.35
216 0.37
217 0.39
218 0.42
219 0.38
220 0.42
221 0.43
222 0.35
223 0.35
224 0.36
225 0.33
226 0.29
227 0.29
228 0.25
229 0.23
230 0.2