Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PIR7

Protein Details
Accession J3PIR7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-47RPLLRRTSRRPRSIHPRRARPSHHBasic
NLS Segment(s)
PositionSequence
27-46LRRTSRRPRSIHPRRARPSH
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MRQRYGVWKSRPTYGRLYSAGQARPLLRRTSRRPRSIHPRRARPSHHPIHHGRQTFGAQLLHRNQRTGWVGSRDAETSALRRGDWSPRHTQPAELRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.47
4 0.47
5 0.42
6 0.45
7 0.42
8 0.36
9 0.34
10 0.3
11 0.33
12 0.32
13 0.34
14 0.34
15 0.41
16 0.48
17 0.57
18 0.64
19 0.67
20 0.69
21 0.71
22 0.76
23 0.79
24 0.81
25 0.79
26 0.8
27 0.79
28 0.82
29 0.79
30 0.76
31 0.74
32 0.73
33 0.67
34 0.63
35 0.61
36 0.62
37 0.62
38 0.55
39 0.46
40 0.4
41 0.37
42 0.31
43 0.28
44 0.21
45 0.16
46 0.19
47 0.25
48 0.3
49 0.3
50 0.3
51 0.28
52 0.32
53 0.35
54 0.33
55 0.31
56 0.28
57 0.29
58 0.29
59 0.31
60 0.26
61 0.23
62 0.22
63 0.18
64 0.16
65 0.2
66 0.19
67 0.18
68 0.19
69 0.21
70 0.29
71 0.34
72 0.38
73 0.42
74 0.47
75 0.55
76 0.54
77 0.59