Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1JEK6

Protein Details
Accession A0A2N1JEK6   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
83-104MWTEVPKSKNKKPVNKDRFISKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR027248  Sm_D2  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005829  C:cytosol  
GO:0030532  C:small nuclear ribonucleoprotein complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01720  Sm_D2  
Amino Acid Sequences MRCVACILTCSQYANVPKSDLDESQIRELEQFEVSQGPLSVLQQSVRNHTQVLISLRNNKKLLARVKAFDRHSNMVLENVKEMWTEVPKSKNKKPVNKDRFISKMFLRGDSVVLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.26
4 0.26
5 0.27
6 0.29
7 0.24
8 0.23
9 0.24
10 0.25
11 0.28
12 0.28
13 0.25
14 0.23
15 0.23
16 0.21
17 0.17
18 0.14
19 0.1
20 0.1
21 0.1
22 0.1
23 0.09
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.14
31 0.15
32 0.2
33 0.21
34 0.21
35 0.2
36 0.2
37 0.2
38 0.18
39 0.2
40 0.19
41 0.19
42 0.28
43 0.3
44 0.35
45 0.35
46 0.32
47 0.32
48 0.34
49 0.38
50 0.36
51 0.36
52 0.33
53 0.38
54 0.44
55 0.44
56 0.43
57 0.42
58 0.38
59 0.37
60 0.35
61 0.31
62 0.28
63 0.28
64 0.23
65 0.18
66 0.16
67 0.15
68 0.13
69 0.14
70 0.11
71 0.12
72 0.15
73 0.18
74 0.26
75 0.33
76 0.41
77 0.48
78 0.56
79 0.62
80 0.7
81 0.76
82 0.79
83 0.82
84 0.83
85 0.8
86 0.78
87 0.76
88 0.69
89 0.63
90 0.54
91 0.52
92 0.45
93 0.43
94 0.38
95 0.32
96 0.3