Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P000

Protein Details
Accession J3P000    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
212-238GAPGPPGRGRRVRRRGPHRGRRGGCGGBasic
NLS Segment(s)
PositionSequence
207-270ARAPRGAPGPPGRGRRVRRRGPHRGRRGGCGGGGPIRRGAQAPGADRAAADAPGRRAGGRDRPG
Subcellular Location(s) nucl 12, cyto 5, pero 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR044995  TMT/HOL  
IPR008854  TPMT  
Gene Ontology GO:0008757  F:S-adenosylmethionine-dependent methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF05724  TPMT  
PROSITE View protein in PROSITE  
PS51585  SAM_MT_TPMT  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MAIQQPDKLLNLFKDQPLAEHGSRWDGLWREEFTPWDRAGPSMALQDLLADRPDLVPPPPPPSAAARPKALVPGCGRGYDVLLLAAFGYDAYGVDYSAEATKEAALYQEKIRAENDERYRPRDGRAQGHVKWLTGDFFADDWIREAGADKFDLIFDYTFFCALPVSARPAWAGRLTQLLAPGGRVVCLQWPTEKPWSTGGPPWGGEARAPRGAPGPPGRGRRVRRRGPHRGRRGGCGGGGPIRRGAQAPGADRAAADAPGRRAGGRDRPGPDSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.32
4 0.32
5 0.37
6 0.3
7 0.29
8 0.29
9 0.28
10 0.28
11 0.27
12 0.28
13 0.23
14 0.26
15 0.28
16 0.29
17 0.27
18 0.29
19 0.31
20 0.29
21 0.32
22 0.29
23 0.28
24 0.25
25 0.23
26 0.24
27 0.22
28 0.2
29 0.17
30 0.17
31 0.14
32 0.13
33 0.14
34 0.12
35 0.12
36 0.11
37 0.09
38 0.09
39 0.09
40 0.11
41 0.11
42 0.11
43 0.16
44 0.17
45 0.23
46 0.23
47 0.23
48 0.24
49 0.29
50 0.38
51 0.4
52 0.42
53 0.39
54 0.39
55 0.39
56 0.43
57 0.37
58 0.33
59 0.27
60 0.3
61 0.29
62 0.28
63 0.28
64 0.22
65 0.22
66 0.18
67 0.15
68 0.09
69 0.07
70 0.07
71 0.06
72 0.05
73 0.04
74 0.03
75 0.03
76 0.02
77 0.03
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.06
85 0.07
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.08
92 0.08
93 0.1
94 0.11
95 0.15
96 0.15
97 0.16
98 0.17
99 0.19
100 0.21
101 0.28
102 0.32
103 0.37
104 0.39
105 0.42
106 0.46
107 0.43
108 0.42
109 0.41
110 0.4
111 0.36
112 0.42
113 0.44
114 0.41
115 0.48
116 0.46
117 0.38
118 0.35
119 0.29
120 0.23
121 0.16
122 0.15
123 0.07
124 0.06
125 0.07
126 0.07
127 0.06
128 0.06
129 0.06
130 0.06
131 0.05
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.07
141 0.06
142 0.05
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.06
149 0.06
150 0.07
151 0.06
152 0.11
153 0.11
154 0.12
155 0.13
156 0.13
157 0.15
158 0.15
159 0.15
160 0.1
161 0.13
162 0.13
163 0.13
164 0.14
165 0.13
166 0.11
167 0.11
168 0.12
169 0.09
170 0.09
171 0.08
172 0.07
173 0.1
174 0.12
175 0.12
176 0.15
177 0.17
178 0.22
179 0.29
180 0.31
181 0.29
182 0.31
183 0.34
184 0.32
185 0.34
186 0.33
187 0.28
188 0.26
189 0.27
190 0.25
191 0.22
192 0.21
193 0.21
194 0.22
195 0.23
196 0.23
197 0.22
198 0.23
199 0.24
200 0.28
201 0.3
202 0.33
203 0.36
204 0.42
205 0.48
206 0.54
207 0.61
208 0.66
209 0.71
210 0.73
211 0.77
212 0.82
213 0.87
214 0.89
215 0.92
216 0.91
217 0.92
218 0.85
219 0.81
220 0.76
221 0.68
222 0.57
223 0.49
224 0.41
225 0.37
226 0.37
227 0.31
228 0.28
229 0.27
230 0.27
231 0.25
232 0.24
233 0.23
234 0.26
235 0.28
236 0.29
237 0.29
238 0.28
239 0.26
240 0.27
241 0.22
242 0.18
243 0.17
244 0.17
245 0.18
246 0.22
247 0.23
248 0.21
249 0.23
250 0.29
251 0.37
252 0.4
253 0.45
254 0.46
255 0.52