Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NNQ1

Protein Details
Accession J3NNQ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVHRPTNKNPYKPNQTEKKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MVHRPTNKNPYKPNQTEKKATAAAAAHLAMRHTVRPRPPSLPGNVDDAAPSYCPAAAEGVSRSVPLFRSLALPAGWVSLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.72
5 0.69
6 0.6
7 0.51
8 0.45
9 0.35
10 0.29
11 0.22
12 0.2
13 0.14
14 0.12
15 0.12
16 0.1
17 0.1
18 0.12
19 0.14
20 0.18
21 0.23
22 0.27
23 0.31
24 0.32
25 0.37
26 0.37
27 0.37
28 0.37
29 0.32
30 0.32
31 0.29
32 0.26
33 0.21
34 0.18
35 0.16
36 0.12
37 0.11
38 0.06
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.11
47 0.11
48 0.11
49 0.11
50 0.11
51 0.12
52 0.13
53 0.13
54 0.11
55 0.14
56 0.14
57 0.17
58 0.15
59 0.16
60 0.13
61 0.14