Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1JEN4

Protein Details
Accession A0A2N1JEN4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
274-293NEAPSAPLTRKEKRRRARQAHydrophilic
NLS Segment(s)
PositionSequence
283-293RKEKRRRARQA
Subcellular Location(s) plas 15, extr 5, mito 4, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009580  GPI_biosynthesis_protein_Pig-F  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF06699  PIG-F  
Amino Acid Sequences MRTGVWPGRHALQAVLMYVVLQPTLLLLSVVDFARVFPASGERSLPIQVVLLASKILRPGARGAGETLGDVLVWESVLALQGVLLTQAWFTLRMSAWHTMAQGHELRETKSQLHARRMPFHQQLEHMVFSSTSLPILWMAALGGIVLGGAPVHTGYLGTAVLAAYIALLALWPVVHVLGAPPSQEWAQLLMAPWSASPRAVLAYVPALGTCAGAVLGSAALALDWGRAWQTWPLPSVYGALAGLLVGNGVGLLLSMGKMYGSALFALPPPPPSNEAPSAPLTRKEKRRRARQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.15
4 0.13
5 0.13
6 0.12
7 0.08
8 0.06
9 0.05
10 0.05
11 0.06
12 0.05
13 0.04
14 0.04
15 0.05
16 0.08
17 0.08
18 0.09
19 0.08
20 0.09
21 0.12
22 0.12
23 0.11
24 0.09
25 0.14
26 0.16
27 0.17
28 0.19
29 0.17
30 0.19
31 0.2
32 0.19
33 0.14
34 0.12
35 0.11
36 0.11
37 0.1
38 0.09
39 0.08
40 0.08
41 0.09
42 0.1
43 0.11
44 0.11
45 0.12
46 0.14
47 0.19
48 0.2
49 0.2
50 0.2
51 0.2
52 0.19
53 0.18
54 0.15
55 0.1
56 0.08
57 0.07
58 0.06
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.03
73 0.03
74 0.04
75 0.05
76 0.05
77 0.06
78 0.09
79 0.09
80 0.1
81 0.14
82 0.16
83 0.17
84 0.18
85 0.18
86 0.16
87 0.16
88 0.18
89 0.17
90 0.15
91 0.18
92 0.18
93 0.19
94 0.21
95 0.23
96 0.2
97 0.25
98 0.31
99 0.33
100 0.4
101 0.44
102 0.45
103 0.5
104 0.52
105 0.53
106 0.52
107 0.5
108 0.43
109 0.38
110 0.39
111 0.36
112 0.32
113 0.24
114 0.19
115 0.16
116 0.15
117 0.14
118 0.09
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.01
136 0.01
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.03
165 0.05
166 0.06
167 0.06
168 0.06
169 0.08
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.09
176 0.09
177 0.09
178 0.09
179 0.09
180 0.08
181 0.08
182 0.08
183 0.08
184 0.07
185 0.07
186 0.08
187 0.08
188 0.08
189 0.07
190 0.08
191 0.08
192 0.08
193 0.07
194 0.07
195 0.07
196 0.07
197 0.05
198 0.04
199 0.04
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.02
207 0.02
208 0.03
209 0.03
210 0.03
211 0.03
212 0.04
213 0.05
214 0.05
215 0.07
216 0.1
217 0.14
218 0.16
219 0.18
220 0.19
221 0.19
222 0.19
223 0.2
224 0.16
225 0.14
226 0.11
227 0.09
228 0.08
229 0.07
230 0.06
231 0.04
232 0.04
233 0.02
234 0.02
235 0.02
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.03
242 0.03
243 0.03
244 0.03
245 0.04
246 0.04
247 0.06
248 0.06
249 0.07
250 0.07
251 0.08
252 0.1
253 0.12
254 0.12
255 0.15
256 0.16
257 0.18
258 0.23
259 0.25
260 0.31
261 0.34
262 0.35
263 0.35
264 0.38
265 0.41
266 0.4
267 0.45
268 0.45
269 0.5
270 0.59
271 0.66
272 0.72
273 0.77