FuNGI

A0A2N1J8U8

Protein Details

Accession

A0A2N1J8U8

Localization Confidence

Medium

Confidence Score

13.4

NoLS Segment(s)

Position	Sequence	Protein Nature
82-101	FATPRGKQPRPVRHARPTLS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 21, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR024957 Cep57_MT-bd_dom
Gene Ontology	GO:0005737 C:cytoplasm GO:0008017 F:microtubule binding
Pfam	View protein in Pfam PF06657 Cep57_MT_bd

Amino Acid Sequences

MRHGSGGDFAIPVSAEEQLRRDIEHELDVHMKPSPNFFARRNAPLHMGLRGTPLRTAFYEDESDTSDDEMLMRSTGNHGALFATPRGKQPRPVRHARPTLSHAANEQLNIARLAGEAVEDPVPRRRLSPVARLSPQRSRQSSGETKVGSDDGYKKQPAKSVAWAEQQLADMVHCIKTMEREMERLRENAPNVLLERRVDAMEAGLDNQKEQLARLTSQFEAHVASSPASRAPRTDDAIVQLLARLNSAQAPPPEAEQNASLHTGIQRLYDELERVSNAVKHLQHTAVGTRAHTPPLRPSAFPLTPPYKEECTEPDEYPHAQERYEAICRTVAEALGLAPHASPRQTEHEKHTRKDKIRASMRHRVAEDMATESLLRRLAETPAPVLAKHELRLLEHLFEQHKREFLHQRQLYSELADELKCMEPGMDKAKRRILAKHVHESIDSLEAEATRINDLRAHLARQGYTMH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.12
2	0.12
3	0.14
4	0.16
5	0.2
6	0.21
7	0.21
8	0.22
9	0.22
10	0.23
11	0.25
12	0.24
13	0.23
14	0.27
15	0.27
16	0.27
17	0.27
18	0.28
19	0.25
20	0.29
21	0.32
22	0.33
23	0.38
24	0.4
25	0.46
26	0.49
27	0.55
28	0.53
29	0.5
30	0.48
31	0.49
32	0.48
33	0.41
34	0.37
35	0.3
36	0.34
37	0.33
38	0.3
39	0.26
40	0.25
41	0.25
42	0.24
43	0.3
44	0.25
45	0.25
46	0.28
47	0.26
48	0.26
49	0.26
50	0.26
51	0.2
52	0.19
53	0.16
54	0.12
55	0.12
56	0.12
57	0.09
58	0.08
59	0.08
60	0.08
61	0.1
62	0.13
63	0.14
64	0.13
65	0.13
66	0.14
67	0.15
68	0.17
69	0.17
70	0.18
71	0.18
72	0.26
73	0.34
74	0.35
75	0.42
76	0.5
77	0.59
78	0.63
79	0.72
80	0.74
81	0.76
82	0.82
83	0.77
84	0.73
85	0.68
86	0.68
87	0.6
88	0.52
89	0.43
90	0.38
91	0.35
92	0.29
93	0.26
94	0.18
95	0.17
96	0.16
97	0.15
98	0.1
99	0.09
100	0.09
101	0.07
102	0.06
103	0.05
104	0.07
105	0.09
106	0.09
107	0.1
108	0.17
109	0.2
110	0.19
111	0.21
112	0.23
113	0.29
114	0.34
115	0.43
116	0.44
117	0.49
118	0.54
119	0.58
120	0.61
121	0.61
122	0.65
123	0.63
124	0.58
125	0.56
126	0.53
127	0.56
128	0.57
129	0.52
130	0.49
131	0.41
132	0.38
133	0.34
134	0.32
135	0.24
136	0.2
137	0.21
138	0.2
139	0.25
140	0.27
141	0.29
142	0.31
143	0.35
144	0.36
145	0.34
146	0.37
147	0.38
148	0.4
149	0.42
150	0.41
151	0.37
152	0.34
153	0.31
154	0.24
155	0.18
156	0.12
157	0.09
158	0.09
159	0.08
160	0.07
161	0.07
162	0.07
163	0.09
164	0.12
165	0.16
166	0.15
167	0.2
168	0.22
169	0.27
170	0.28
171	0.27
172	0.27
173	0.26
174	0.27
175	0.24
176	0.22
177	0.19
178	0.18
179	0.18
180	0.17
181	0.13
182	0.14
183	0.12
184	0.12
185	0.1
186	0.09
187	0.08
188	0.07
189	0.07
190	0.07
191	0.08
192	0.08
193	0.08
194	0.08
195	0.09
196	0.08
197	0.08
198	0.11
199	0.1
200	0.11
201	0.13
202	0.15
203	0.15
204	0.15
205	0.15
206	0.12
207	0.11
208	0.11
209	0.1
210	0.08
211	0.08
212	0.08
213	0.08
214	0.1
215	0.11
216	0.11
217	0.1
218	0.14
219	0.17
220	0.19
221	0.2
222	0.18
223	0.19
224	0.2
225	0.2
226	0.14
227	0.12
228	0.11
229	0.09
230	0.09
231	0.07
232	0.06
233	0.07
234	0.08
235	0.1
236	0.09
237	0.11
238	0.11
239	0.13
240	0.14
241	0.13
242	0.13
243	0.11
244	0.12
245	0.11
246	0.12
247	0.1
248	0.09
249	0.1
250	0.1
251	0.09
252	0.09
253	0.09
254	0.08
255	0.1
256	0.1
257	0.1
258	0.09
259	0.1
260	0.09
261	0.09
262	0.1
263	0.1
264	0.1
265	0.14
266	0.15
267	0.16
268	0.18
269	0.18
270	0.18
271	0.18
272	0.18
273	0.17
274	0.17
275	0.16
276	0.17
277	0.18
278	0.2
279	0.21
280	0.21
281	0.22
282	0.3
283	0.31
284	0.28
285	0.31
286	0.35
287	0.35
288	0.35
289	0.36
290	0.33
291	0.33
292	0.35
293	0.35
294	0.3
295	0.3
296	0.3
297	0.26
298	0.26
299	0.29
300	0.27
301	0.25
302	0.26
303	0.25
304	0.27
305	0.3
306	0.25
307	0.21
308	0.22
309	0.22
310	0.23
311	0.27
312	0.25
313	0.19
314	0.21
315	0.21
316	0.22
317	0.2
318	0.15
319	0.11
320	0.11
321	0.09
322	0.08
323	0.08
324	0.06
325	0.05
326	0.06
327	0.07
328	0.08
329	0.08
330	0.11
331	0.2
332	0.27
333	0.3
334	0.38
335	0.47
336	0.54
337	0.58
338	0.65
339	0.66
340	0.66
341	0.72
342	0.71
343	0.7
344	0.73
345	0.78
346	0.77
347	0.77
348	0.77
349	0.73
350	0.67
351	0.59
352	0.51
353	0.44
354	0.36
355	0.29
356	0.23
357	0.17
358	0.17
359	0.14
360	0.15
361	0.14
362	0.13
363	0.11
364	0.13
365	0.15
366	0.18
367	0.19
368	0.19
369	0.21
370	0.22
371	0.2
372	0.21
373	0.24
374	0.23
375	0.22
376	0.25
377	0.22
378	0.23
379	0.28
380	0.27
381	0.24
382	0.23
383	0.27
384	0.27
385	0.3
386	0.33
387	0.3
388	0.33
389	0.32
390	0.39
391	0.44
392	0.48
393	0.55
394	0.54
395	0.53
396	0.52
397	0.54
398	0.47
399	0.38
400	0.32
401	0.23
402	0.22
403	0.2
404	0.17
405	0.16
406	0.17
407	0.15
408	0.14
409	0.12
410	0.12
411	0.17
412	0.26
413	0.31
414	0.34
415	0.41
416	0.48
417	0.53
418	0.54
419	0.57
420	0.57
421	0.6
422	0.63
423	0.67
424	0.64
425	0.61
426	0.58
427	0.52
428	0.45
429	0.39
430	0.31
431	0.21
432	0.18
433	0.16
434	0.16
435	0.16
436	0.15
437	0.13
438	0.14
439	0.15
440	0.16
441	0.18
442	0.26
443	0.28
444	0.29
445	0.3
446	0.33
447	0.33

A0A2N1J8U8

3D AlphaFold-predicted Structure Viewer