Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8U6M6

Protein Details
Accession J8U6M6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-79LAIIQKAKRKKPKVRYYGYKKLGYHydrophilic
NLS Segment(s)
PositionSequence
61-69KAKRKKPKV
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences KAFKTKIISGPHKGTPKNTNVLTFKKPVICFKYGQLGHIVIACKIRTNNPETPLALAIIQKAKRKKPKVRYYGYKKLGYIRPACFKKSKILLPNLIPLFGRLSTGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.56
4 0.56
5 0.52
6 0.52
7 0.5
8 0.53
9 0.52
10 0.47
11 0.44
12 0.43
13 0.44
14 0.44
15 0.44
16 0.41
17 0.38
18 0.37
19 0.43
20 0.37
21 0.35
22 0.3
23 0.24
24 0.22
25 0.23
26 0.21
27 0.12
28 0.15
29 0.14
30 0.13
31 0.13
32 0.17
33 0.18
34 0.23
35 0.27
36 0.27
37 0.29
38 0.28
39 0.28
40 0.24
41 0.21
42 0.16
43 0.12
44 0.11
45 0.13
46 0.16
47 0.2
48 0.25
49 0.33
50 0.42
51 0.52
52 0.61
53 0.67
54 0.75
55 0.8
56 0.84
57 0.87
58 0.87
59 0.88
60 0.85
61 0.78
62 0.69
63 0.66
64 0.62
65 0.58
66 0.55
67 0.49
68 0.52
69 0.52
70 0.55
71 0.53
72 0.49
73 0.51
74 0.52
75 0.55
76 0.53
77 0.58
78 0.6
79 0.58
80 0.65
81 0.56
82 0.5
83 0.42
84 0.35
85 0.3
86 0.24