Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2N1JDL6

Protein Details
Accession A0A2N1JDL6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-29ATSIPIVKKRTQKFKRHQSDRFKRVGEHydrophilic
NLS Segment(s)
PositionSequence
17-17K
Subcellular Location(s) mito 14.5, mito_nucl 11, nucl 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAATSIPIVKKRTQKFKRHQSDRFKRVGESWRKPTGIDNCVRRRFRGTIAMPKIGYGSNKKTRNLMPNGFRRFVVHNVNEVDLLLMHNNSFAAEVAHNVSSKKRIEILNKAKVLGVRVTNANARVRAQEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.78
3 0.85
4 0.9
5 0.91
6 0.91
7 0.91
8 0.92
9 0.9
10 0.87
11 0.77
12 0.68
13 0.64
14 0.64
15 0.64
16 0.61
17 0.6
18 0.59
19 0.58
20 0.56
21 0.57
22 0.54
23 0.51
24 0.48
25 0.5
26 0.53
27 0.62
28 0.63
29 0.57
30 0.55
31 0.5
32 0.48
33 0.48
34 0.43
35 0.45
36 0.47
37 0.49
38 0.43
39 0.4
40 0.38
41 0.29
42 0.27
43 0.21
44 0.24
45 0.3
46 0.34
47 0.35
48 0.38
49 0.41
50 0.47
51 0.48
52 0.47
53 0.45
54 0.5
55 0.54
56 0.51
57 0.47
58 0.41
59 0.37
60 0.36
61 0.35
62 0.27
63 0.27
64 0.27
65 0.27
66 0.25
67 0.22
68 0.17
69 0.1
70 0.1
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.07
82 0.09
83 0.1
84 0.11
85 0.11
86 0.13
87 0.17
88 0.19
89 0.2
90 0.22
91 0.27
92 0.33
93 0.44
94 0.51
95 0.55
96 0.55
97 0.54
98 0.51
99 0.47
100 0.43
101 0.37
102 0.3
103 0.24
104 0.25
105 0.27
106 0.29
107 0.33
108 0.34
109 0.32
110 0.31