Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8RRE6

Protein Details
Accession A0A2G8RRE6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKKSSRKPAPSRRKDPLETNFBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRKPAPSRRK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPAPSRRKDPLETNFTCLFCHHDKSVSVRINRKEGVAQLLCKVCDQRYQSKANHLTEPIDIYSEWIDAADAAEKEASTSTRRTVASSSRAPRAPSVDSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.89
4 0.83
5 0.81
6 0.79
7 0.77
8 0.68
9 0.65
10 0.59
11 0.51
12 0.46
13 0.37
14 0.34
15 0.27
16 0.29
17 0.24
18 0.23
19 0.24
20 0.29
21 0.37
22 0.37
23 0.4
24 0.43
25 0.45
26 0.47
27 0.46
28 0.42
29 0.35
30 0.3
31 0.31
32 0.26
33 0.23
34 0.21
35 0.22
36 0.21
37 0.2
38 0.2
39 0.14
40 0.18
41 0.21
42 0.25
43 0.29
44 0.34
45 0.35
46 0.43
47 0.49
48 0.46
49 0.44
50 0.38
51 0.34
52 0.29
53 0.29
54 0.2
55 0.15
56 0.12
57 0.11
58 0.1
59 0.09
60 0.08
61 0.06
62 0.06
63 0.05
64 0.06
65 0.07
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.09
72 0.1
73 0.1
74 0.12
75 0.14
76 0.19
77 0.2
78 0.21
79 0.25
80 0.3
81 0.35
82 0.42
83 0.45
84 0.47
85 0.49
86 0.5
87 0.49
88 0.48
89 0.44