Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SSF6

Protein Details
Accession A0A2G8SSF6   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-67GGGKAAKKKKWSKGKVKDKAQHABasic
NLS Segment(s)
PositionSequence
36-63AKAKAAPTSGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 12, cyto_nucl 11.5, cyto 9, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MGVAYSIPDRIRPSVTEQKAGREPPNIQRSAFKTMAKAKAAPTSGGGKAAKKKKWSKGKVKDKAQHAVVLDKATYDRILKEVPTFRFISQSILIERLKVNGSLARVAIRHLEKEGQIKRIVHHSSQLVYTRATGGGGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.47
4 0.44
5 0.49
6 0.52
7 0.55
8 0.5
9 0.44
10 0.46
11 0.48
12 0.55
13 0.5
14 0.45
15 0.46
16 0.47
17 0.49
18 0.48
19 0.39
20 0.37
21 0.43
22 0.48
23 0.44
24 0.41
25 0.36
26 0.38
27 0.38
28 0.32
29 0.27
30 0.25
31 0.23
32 0.25
33 0.24
34 0.22
35 0.3
36 0.37
37 0.39
38 0.44
39 0.52
40 0.57
41 0.67
42 0.73
43 0.76
44 0.79
45 0.86
46 0.87
47 0.88
48 0.85
49 0.8
50 0.76
51 0.65
52 0.57
53 0.47
54 0.39
55 0.3
56 0.24
57 0.18
58 0.12
59 0.11
60 0.09
61 0.09
62 0.07
63 0.07
64 0.08
65 0.09
66 0.09
67 0.14
68 0.19
69 0.2
70 0.23
71 0.24
72 0.23
73 0.25
74 0.25
75 0.24
76 0.2
77 0.2
78 0.18
79 0.2
80 0.2
81 0.18
82 0.18
83 0.16
84 0.16
85 0.14
86 0.14
87 0.12
88 0.14
89 0.14
90 0.14
91 0.14
92 0.13
93 0.14
94 0.19
95 0.19
96 0.19
97 0.19
98 0.22
99 0.23
100 0.32
101 0.35
102 0.34
103 0.37
104 0.37
105 0.37
106 0.43
107 0.44
108 0.37
109 0.38
110 0.37
111 0.34
112 0.38
113 0.4
114 0.32
115 0.29
116 0.28
117 0.24
118 0.21
119 0.19