Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8S836

Protein Details
Accession A0A2G8S836    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-94DISGSRKSPERRLGRRPKAILHydrophilic
NLS Segment(s)
PositionSequence
79-92RKSPERRLGRRPKA
Subcellular Location(s) mito_nucl 12.666, mito 12.5, nucl 11.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MPIPPRKYAPNSEVLWCYTSPLRPHAPRDWRTGTIANGKPEAPFFSQKRKCWLYPVIVDRPTGPRILYWVRENDISGSRKSPERRLGRRPKAIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.3
4 0.29
5 0.24
6 0.26
7 0.24
8 0.27
9 0.33
10 0.35
11 0.41
12 0.47
13 0.54
14 0.53
15 0.59
16 0.59
17 0.53
18 0.52
19 0.48
20 0.42
21 0.42
22 0.41
23 0.36
24 0.32
25 0.3
26 0.26
27 0.25
28 0.24
29 0.18
30 0.21
31 0.21
32 0.31
33 0.37
34 0.38
35 0.45
36 0.47
37 0.44
38 0.43
39 0.45
40 0.39
41 0.39
42 0.44
43 0.43
44 0.4
45 0.39
46 0.35
47 0.35
48 0.31
49 0.26
50 0.2
51 0.13
52 0.17
53 0.21
54 0.23
55 0.23
56 0.26
57 0.27
58 0.28
59 0.28
60 0.26
61 0.29
62 0.28
63 0.26
64 0.25
65 0.26
66 0.32
67 0.37
68 0.42
69 0.46
70 0.54
71 0.61
72 0.69
73 0.78
74 0.81