Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SHZ7

Protein Details
Accession A0A2G8SHZ7   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-107DDPETKRKTRDKMRFKVRRAQKRWREKQAKDTQLEBasic
NLS Segment(s)
PositionSequence
78-99KRKTRDKMRFKVRRAQKRWREK
Subcellular Location(s) nucl 12, pero 6, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences MAPSEQRDPGSASNADVGPLPPWFRRKLTVLGGTGPVKAETTSTLLANGAHDTPEKIPPWRDLQRKGAFVTPDDPETKRKTRDKMRFKVRRAQKRWREKQAKDTQLESKDDDDSEADADAVASMLLGSNDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.19
4 0.17
5 0.13
6 0.14
7 0.16
8 0.17
9 0.21
10 0.25
11 0.27
12 0.3
13 0.33
14 0.37
15 0.41
16 0.43
17 0.4
18 0.38
19 0.4
20 0.36
21 0.33
22 0.27
23 0.2
24 0.14
25 0.13
26 0.11
27 0.08
28 0.11
29 0.11
30 0.11
31 0.11
32 0.1
33 0.11
34 0.11
35 0.1
36 0.08
37 0.07
38 0.07
39 0.08
40 0.1
41 0.14
42 0.14
43 0.15
44 0.17
45 0.19
46 0.26
47 0.33
48 0.37
49 0.38
50 0.46
51 0.48
52 0.48
53 0.47
54 0.43
55 0.35
56 0.31
57 0.28
58 0.2
59 0.18
60 0.18
61 0.18
62 0.19
63 0.25
64 0.29
65 0.34
66 0.39
67 0.46
68 0.54
69 0.63
70 0.7
71 0.74
72 0.8
73 0.82
74 0.81
75 0.82
76 0.82
77 0.82
78 0.8
79 0.81
80 0.8
81 0.82
82 0.87
83 0.89
84 0.89
85 0.83
86 0.86
87 0.85
88 0.84
89 0.76
90 0.71
91 0.67
92 0.61
93 0.59
94 0.5
95 0.42
96 0.34
97 0.31
98 0.28
99 0.21
100 0.17
101 0.15
102 0.12
103 0.1
104 0.08
105 0.08
106 0.07
107 0.06
108 0.04
109 0.03
110 0.03
111 0.04