Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PKJ5

Protein Details
Accession J3PKJ5   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
149-177VAWYVRDRIQRRRKRQKRQFRRALTERAGHydrophilic
NLS Segment(s)
PositionSequence
157-182IQRRRKRQKRQFRRALTERAGVGKVK
Subcellular Location(s) nucl 17, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MATATAPVTGTPLPFKPQTPITPPPDCLNFPPKQSQSPLKEKEPAAEVMAQVAGHIQTLPTKDQRTENGCECHEGDGSAVTAPPPPPPPPAPGTGPLDPRYIAMVSRIAAYYQQRCQAISNFQHQKCQAWANVQRQKTQEMTQAALLVVAWYVRDRIQRRRKRQKRQFRRALTERAGVGKVKKEESVSKWASHIPDDLLAPDSGLKERPIDKDELDFTMDFEPTADSDSKLYSVADNMIKSQLARIDVPLMGALSFTDDEQSESESDYEELHRWRPEPEAQPRGGQGSERVAAEEEDYDDDASDYSYDDDDMEDFTADHNSERVHKSTGNNARAGGSSSLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.29
4 0.34
5 0.4
6 0.43
7 0.5
8 0.52
9 0.55
10 0.56
11 0.56
12 0.54
13 0.5
14 0.48
15 0.48
16 0.44
17 0.44
18 0.51
19 0.5
20 0.5
21 0.54
22 0.58
23 0.58
24 0.65
25 0.67
26 0.63
27 0.66
28 0.61
29 0.58
30 0.52
31 0.45
32 0.38
33 0.33
34 0.27
35 0.21
36 0.21
37 0.17
38 0.13
39 0.12
40 0.09
41 0.07
42 0.07
43 0.06
44 0.09
45 0.11
46 0.16
47 0.21
48 0.24
49 0.26
50 0.31
51 0.38
52 0.41
53 0.44
54 0.47
55 0.46
56 0.44
57 0.44
58 0.41
59 0.35
60 0.3
61 0.24
62 0.18
63 0.13
64 0.13
65 0.1
66 0.09
67 0.07
68 0.09
69 0.1
70 0.12
71 0.15
72 0.16
73 0.21
74 0.23
75 0.28
76 0.28
77 0.32
78 0.32
79 0.33
80 0.37
81 0.36
82 0.38
83 0.36
84 0.34
85 0.3
86 0.27
87 0.25
88 0.19
89 0.15
90 0.13
91 0.12
92 0.11
93 0.12
94 0.12
95 0.1
96 0.13
97 0.17
98 0.19
99 0.21
100 0.25
101 0.25
102 0.25
103 0.27
104 0.28
105 0.31
106 0.31
107 0.37
108 0.42
109 0.42
110 0.47
111 0.46
112 0.44
113 0.39
114 0.39
115 0.31
116 0.29
117 0.37
118 0.41
119 0.47
120 0.47
121 0.49
122 0.47
123 0.48
124 0.42
125 0.37
126 0.33
127 0.28
128 0.28
129 0.24
130 0.23
131 0.2
132 0.17
133 0.14
134 0.07
135 0.05
136 0.04
137 0.04
138 0.03
139 0.04
140 0.07
141 0.13
142 0.17
143 0.28
144 0.39
145 0.49
146 0.6
147 0.71
148 0.79
149 0.84
150 0.91
151 0.92
152 0.93
153 0.94
154 0.94
155 0.9
156 0.89
157 0.84
158 0.81
159 0.72
160 0.63
161 0.53
162 0.45
163 0.37
164 0.29
165 0.25
166 0.21
167 0.2
168 0.18
169 0.19
170 0.19
171 0.22
172 0.25
173 0.32
174 0.3
175 0.29
176 0.29
177 0.3
178 0.29
179 0.25
180 0.22
181 0.14
182 0.13
183 0.13
184 0.12
185 0.11
186 0.1
187 0.09
188 0.09
189 0.09
190 0.08
191 0.09
192 0.09
193 0.1
194 0.14
195 0.17
196 0.19
197 0.2
198 0.2
199 0.22
200 0.23
201 0.22
202 0.21
203 0.17
204 0.16
205 0.15
206 0.14
207 0.11
208 0.1
209 0.09
210 0.07
211 0.1
212 0.09
213 0.08
214 0.09
215 0.09
216 0.1
217 0.1
218 0.1
219 0.08
220 0.08
221 0.11
222 0.13
223 0.13
224 0.13
225 0.14
226 0.14
227 0.14
228 0.14
229 0.13
230 0.13
231 0.13
232 0.13
233 0.14
234 0.14
235 0.14
236 0.13
237 0.11
238 0.08
239 0.08
240 0.07
241 0.06
242 0.07
243 0.06
244 0.07
245 0.07
246 0.08
247 0.09
248 0.11
249 0.09
250 0.1
251 0.1
252 0.1
253 0.1
254 0.1
255 0.12
256 0.13
257 0.16
258 0.19
259 0.22
260 0.21
261 0.23
262 0.26
263 0.32
264 0.38
265 0.46
266 0.49
267 0.48
268 0.5
269 0.5
270 0.48
271 0.41
272 0.32
273 0.26
274 0.23
275 0.24
276 0.21
277 0.21
278 0.19
279 0.18
280 0.18
281 0.16
282 0.13
283 0.12
284 0.13
285 0.12
286 0.11
287 0.11
288 0.1
289 0.1
290 0.08
291 0.07
292 0.07
293 0.08
294 0.08
295 0.08
296 0.08
297 0.08
298 0.09
299 0.09
300 0.08
301 0.08
302 0.09
303 0.11
304 0.11
305 0.11
306 0.12
307 0.13
308 0.19
309 0.23
310 0.26
311 0.27
312 0.31
313 0.34
314 0.43
315 0.51
316 0.51
317 0.48
318 0.46
319 0.44
320 0.41
321 0.41
322 0.34