Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AGA4

Protein Details
Accession G3AGA4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
167-192AIRQRLKEEKRVKKLQREKRQLDNDGBasic
NLS Segment(s)
PositionSequence
174-182EEKRVKKLQ
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0000307  C:cyclin-dependent protein kinase holoenzyme complex  
GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
KEGG spaa:SPAPADRAFT_58452  -  
Pfam View protein in Pfam  
PF08613  Cyclin  
Amino Acid Sequences MTSSSATGPAPSSFQSQPVQQPFTNAFPQSIVTDRSVPGSGTSTMTSTPVNSIAIPQRNNQLQVEESGEPMVRSASSLSSQLAPPQHKQIPYEPPEPDHYMTYSEFLENITNKDVDLETPGGNVYEEHLNIVDYPVNDLIVMLACLLSKIIEANDKLHPNHFENTIAIRQRLKEEKRVKKLQREKRQLDNDGDVDIDRNHDDDASMKAGDNHDSMDFENDDNGDDEDDDEDEMKNKYLANVLAFHGTNVPGISLHAYLARVLKYCPVTNEVFLSLLVYFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.28
4 0.36
5 0.41
6 0.45
7 0.39
8 0.43
9 0.43
10 0.45
11 0.46
12 0.38
13 0.31
14 0.27
15 0.28
16 0.25
17 0.25
18 0.22
19 0.19
20 0.21
21 0.21
22 0.23
23 0.22
24 0.2
25 0.18
26 0.19
27 0.17
28 0.17
29 0.17
30 0.15
31 0.15
32 0.16
33 0.15
34 0.12
35 0.13
36 0.12
37 0.12
38 0.11
39 0.15
40 0.21
41 0.27
42 0.28
43 0.29
44 0.35
45 0.37
46 0.4
47 0.36
48 0.31
49 0.26
50 0.26
51 0.28
52 0.21
53 0.18
54 0.17
55 0.16
56 0.14
57 0.13
58 0.11
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.1
65 0.11
66 0.12
67 0.12
68 0.15
69 0.2
70 0.22
71 0.23
72 0.29
73 0.33
74 0.33
75 0.35
76 0.38
77 0.41
78 0.44
79 0.47
80 0.41
81 0.39
82 0.42
83 0.43
84 0.38
85 0.3
86 0.25
87 0.22
88 0.21
89 0.2
90 0.16
91 0.12
92 0.11
93 0.11
94 0.12
95 0.11
96 0.12
97 0.12
98 0.11
99 0.11
100 0.12
101 0.11
102 0.09
103 0.1
104 0.11
105 0.09
106 0.09
107 0.09
108 0.08
109 0.08
110 0.08
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.08
120 0.06
121 0.07
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.07
139 0.07
140 0.1
141 0.14
142 0.17
143 0.18
144 0.2
145 0.23
146 0.23
147 0.24
148 0.23
149 0.19
150 0.18
151 0.2
152 0.22
153 0.21
154 0.2
155 0.19
156 0.19
157 0.24
158 0.32
159 0.32
160 0.37
161 0.46
162 0.55
163 0.62
164 0.72
165 0.73
166 0.76
167 0.83
168 0.84
169 0.84
170 0.85
171 0.82
172 0.81
173 0.83
174 0.77
175 0.71
176 0.64
177 0.54
178 0.43
179 0.38
180 0.28
181 0.21
182 0.16
183 0.13
184 0.09
185 0.09
186 0.09
187 0.08
188 0.08
189 0.08
190 0.11
191 0.11
192 0.11
193 0.11
194 0.13
195 0.14
196 0.16
197 0.15
198 0.14
199 0.12
200 0.13
201 0.13
202 0.14
203 0.14
204 0.12
205 0.13
206 0.11
207 0.12
208 0.12
209 0.12
210 0.09
211 0.08
212 0.09
213 0.08
214 0.09
215 0.08
216 0.08
217 0.08
218 0.09
219 0.1
220 0.1
221 0.1
222 0.1
223 0.11
224 0.14
225 0.16
226 0.16
227 0.18
228 0.18
229 0.22
230 0.21
231 0.21
232 0.19
233 0.17
234 0.16
235 0.14
236 0.13
237 0.08
238 0.09
239 0.11
240 0.1
241 0.1
242 0.11
243 0.11
244 0.13
245 0.16
246 0.17
247 0.16
248 0.16
249 0.22
250 0.25
251 0.28
252 0.29
253 0.31
254 0.32
255 0.33
256 0.35
257 0.3
258 0.25
259 0.22
260 0.21