Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SQM2

Protein Details
Accession A0A2G8SQM2   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
82-124NTKGQEYQPSQRKRKRKHGFLTRKRSVNGRKMLARRRAKGRLFHydrophilic
NLS Segment(s)
PositionSequence
93-122RKRKRKHGFLTRKRSVNGRKMLARRRAKGR
Subcellular Location(s) mito 15.5, mito_nucl 13.166, nucl 9.5, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPPSLARLLSRPPSLPAAVPRPATSVSFASSHTPFRPILPSATPTSSLLRLLPTLMTRFNSVPSTLSPMFTPLLQVRHNTKGQEYQPSQRKRKRKHGFLTRKRSVNGRKMLARRRAKGRLFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.35
4 0.34
5 0.33
6 0.32
7 0.32
8 0.34
9 0.34
10 0.32
11 0.3
12 0.3
13 0.29
14 0.25
15 0.21
16 0.18
17 0.17
18 0.18
19 0.19
20 0.19
21 0.21
22 0.19
23 0.21
24 0.19
25 0.2
26 0.22
27 0.2
28 0.21
29 0.2
30 0.22
31 0.22
32 0.23
33 0.23
34 0.21
35 0.21
36 0.19
37 0.18
38 0.15
39 0.13
40 0.12
41 0.11
42 0.1
43 0.09
44 0.1
45 0.1
46 0.11
47 0.12
48 0.12
49 0.13
50 0.13
51 0.12
52 0.12
53 0.11
54 0.17
55 0.15
56 0.15
57 0.14
58 0.15
59 0.15
60 0.13
61 0.15
62 0.11
63 0.14
64 0.15
65 0.18
66 0.21
67 0.26
68 0.28
69 0.27
70 0.27
71 0.31
72 0.32
73 0.39
74 0.38
75 0.42
76 0.49
77 0.58
78 0.66
79 0.67
80 0.75
81 0.75
82 0.83
83 0.84
84 0.85
85 0.87
86 0.88
87 0.91
88 0.92
89 0.93
90 0.9
91 0.86
92 0.77
93 0.76
94 0.74
95 0.72
96 0.7
97 0.67
98 0.67
99 0.7
100 0.77
101 0.78
102 0.78
103 0.77
104 0.78
105 0.8
106 0.77
107 0.77