Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8S9Z6

Protein Details
Accession A0A2G8S9Z6   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-27VGGTRRTTNPLRKHHARCRNRDQDADHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045169  NO2/SO3_Rdtase_4Fe4S_prot  
Gene Ontology GO:0020037  F:heme binding  
GO:0051536  F:iron-sulfur cluster binding  
GO:0016491  F:oxidoreductase activity  
Amino Acid Sequences MVGGTRRTTNPLRKHHARCRNRDQDADGPETGYKLWEPLVWKALGVDAVEVTEAEPEPITNEHIKVASQYLRGTISEGLEDNTTGALAPSDTQLTKFHGIYQQDDRDIRRPTATKRVAPSCSSRVSRSFPALL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.86
4 0.86
5 0.87
6 0.88
7 0.89
8 0.84
9 0.78
10 0.74
11 0.7
12 0.65
13 0.6
14 0.49
15 0.39
16 0.34
17 0.3
18 0.24
19 0.17
20 0.12
21 0.08
22 0.08
23 0.09
24 0.12
25 0.14
26 0.17
27 0.16
28 0.16
29 0.15
30 0.15
31 0.14
32 0.12
33 0.09
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.05
45 0.06
46 0.08
47 0.08
48 0.09
49 0.09
50 0.1
51 0.1
52 0.09
53 0.11
54 0.1
55 0.1
56 0.1
57 0.11
58 0.11
59 0.11
60 0.12
61 0.11
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.07
69 0.06
70 0.05
71 0.04
72 0.04
73 0.03
74 0.03
75 0.04
76 0.05
77 0.06
78 0.07
79 0.08
80 0.1
81 0.14
82 0.17
83 0.16
84 0.18
85 0.22
86 0.24
87 0.27
88 0.33
89 0.33
90 0.34
91 0.36
92 0.37
93 0.39
94 0.41
95 0.39
96 0.38
97 0.39
98 0.41
99 0.49
100 0.53
101 0.52
102 0.56
103 0.61
104 0.59
105 0.59
106 0.6
107 0.55
108 0.56
109 0.54
110 0.5
111 0.48
112 0.5
113 0.51