Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8S175

Protein Details
Accession A0A2G8S175    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-45PKPEPAPKKAPAKPRAKKPSABasic
NLS Segment(s)
PositionSequence
15-68PRRSARIKDLPKPEPAPKKAPAKPRAKKPSAAEGEEKPKSTKGKKRTASEKEAE
75-153NGDEPPAKKAKPASKAGAKPASKAAAPKPASKASRAGSAKPASRAVSAKPASKASAKPPSTAKKPASRAGSKKPASKAG
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MPRKAAVPADSAGEPRRSARIKDLPKPEPAPKKAPAKPRAKKPSAAEGEEKPKSTKGKKRTASEKEAEDGAPEANGDEPPAKKAKPASKAGAKPASKAAAPKPASKASRAGSAKPASRAVSAKPASKASAKPPSTAKKPASRAGSKKPASKAGAAEKENTAAAAPETIAEEPEAEAAANGEPAVEQAAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.3
4 0.3
5 0.32
6 0.39
7 0.45
8 0.51
9 0.59
10 0.67
11 0.62
12 0.67
13 0.7
14 0.7
15 0.7
16 0.67
17 0.64
18 0.62
19 0.68
20 0.67
21 0.71
22 0.72
23 0.73
24 0.76
25 0.8
26 0.83
27 0.78
28 0.78
29 0.73
30 0.74
31 0.69
32 0.65
33 0.58
34 0.53
35 0.57
36 0.52
37 0.49
38 0.39
39 0.38
40 0.41
41 0.46
42 0.49
43 0.5
44 0.58
45 0.64
46 0.7
47 0.77
48 0.77
49 0.76
50 0.72
51 0.65
52 0.56
53 0.5
54 0.41
55 0.31
56 0.24
57 0.15
58 0.11
59 0.08
60 0.06
61 0.05
62 0.05
63 0.06
64 0.07
65 0.08
66 0.1
67 0.13
68 0.13
69 0.14
70 0.21
71 0.27
72 0.31
73 0.36
74 0.39
75 0.44
76 0.47
77 0.51
78 0.53
79 0.47
80 0.41
81 0.39
82 0.34
83 0.27
84 0.26
85 0.23
86 0.23
87 0.25
88 0.27
89 0.29
90 0.34
91 0.34
92 0.34
93 0.36
94 0.28
95 0.35
96 0.34
97 0.31
98 0.32
99 0.34
100 0.35
101 0.33
102 0.34
103 0.26
104 0.27
105 0.27
106 0.22
107 0.27
108 0.27
109 0.28
110 0.28
111 0.28
112 0.28
113 0.3
114 0.31
115 0.3
116 0.38
117 0.35
118 0.36
119 0.42
120 0.48
121 0.5
122 0.56
123 0.54
124 0.52
125 0.56
126 0.6
127 0.61
128 0.62
129 0.63
130 0.64
131 0.69
132 0.65
133 0.66
134 0.64
135 0.63
136 0.58
137 0.55
138 0.5
139 0.5
140 0.53
141 0.48
142 0.46
143 0.39
144 0.38
145 0.34
146 0.29
147 0.19
148 0.11
149 0.1
150 0.08
151 0.07
152 0.06
153 0.08
154 0.08
155 0.09
156 0.08
157 0.08
158 0.08
159 0.09
160 0.08
161 0.06
162 0.06
163 0.07
164 0.07
165 0.06
166 0.06
167 0.05
168 0.05
169 0.05
170 0.07