Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8S1D5

Protein Details
Accession A0A2G8S1D5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-101RCPMTWWWWWRRWRRRRRSRSPCRGWWGRRWRRRGRSGRRLAHRRRRRRRRWWWWBasic
NLS Segment(s)
PositionSequence
57-98RRWRRRRRSRSPCRGWWGRRWRRRGRSGRRLAHRRRRRRRRW
Subcellular Location(s) extr 8, nucl 5, mito 5, mito_nucl 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MPKAHLVLVEVQAILSGRSALLPEEGAEAVEAGLLLQLAGRGRWWWRCPMTWWWWWRRWRRRRRSRSPCRGWWGRRWRRRGRSGRRLAHRRRRRRRRWWWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.08
3 0.06
4 0.05
5 0.05
6 0.06
7 0.06
8 0.06
9 0.06
10 0.07
11 0.08
12 0.08
13 0.08
14 0.07
15 0.07
16 0.06
17 0.05
18 0.05
19 0.03
20 0.03
21 0.03
22 0.02
23 0.02
24 0.03
25 0.04
26 0.04
27 0.04
28 0.06
29 0.09
30 0.14
31 0.16
32 0.21
33 0.23
34 0.24
35 0.28
36 0.33
37 0.36
38 0.37
39 0.41
40 0.4
41 0.45
42 0.52
43 0.59
44 0.64
45 0.69
46 0.74
47 0.8
48 0.86
49 0.9
50 0.93
51 0.94
52 0.95
53 0.95
54 0.93
55 0.91
56 0.89
57 0.88
58 0.82
59 0.8
60 0.81
61 0.8
62 0.8
63 0.81
64 0.83
65 0.83
66 0.88
67 0.89
68 0.89
69 0.89
70 0.91
71 0.91
72 0.91
73 0.92
74 0.92
75 0.92
76 0.92
77 0.92
78 0.93
79 0.95
80 0.95
81 0.95