Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8RX08

Protein Details
Accession A0A2G8RX08    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MPKETTKHTKRKAAEKAEKAPKAKGKKDPKAPKRALSABasic
NLS Segment(s)
PositionSequence
7-34KHTKRKAAEKAEKAPKAKGKKDPKAPKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKETTKHTKRKAAEKAEKAPKAKGKKDPKAPKRALSAYMFFSQDWRERIKAENPDAGFGEIGKLLGAKWKELDDEEKKPYLDQAAADKARAEQEKNEYDGKKADSAGSGDGEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.83
4 0.84
5 0.83
6 0.75
7 0.73
8 0.7
9 0.69
10 0.68
11 0.68
12 0.69
13 0.72
14 0.8
15 0.84
16 0.85
17 0.86
18 0.84
19 0.8
20 0.77
21 0.71
22 0.65
23 0.57
24 0.5
25 0.43
26 0.39
27 0.34
28 0.26
29 0.24
30 0.22
31 0.22
32 0.21
33 0.21
34 0.19
35 0.19
36 0.23
37 0.28
38 0.31
39 0.3
40 0.33
41 0.3
42 0.3
43 0.3
44 0.26
45 0.2
46 0.13
47 0.11
48 0.06
49 0.06
50 0.04
51 0.04
52 0.03
53 0.08
54 0.08
55 0.08
56 0.09
57 0.1
58 0.11
59 0.12
60 0.2
61 0.21
62 0.25
63 0.29
64 0.3
65 0.29
66 0.29
67 0.29
68 0.24
69 0.19
70 0.16
71 0.17
72 0.23
73 0.24
74 0.24
75 0.23
76 0.22
77 0.27
78 0.28
79 0.25
80 0.21
81 0.29
82 0.32
83 0.35
84 0.41
85 0.36
86 0.36
87 0.39
88 0.37
89 0.32
90 0.29
91 0.27
92 0.22
93 0.23
94 0.23
95 0.2
96 0.17
97 0.15