Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P0T1

Protein Details
Accession J3P0T1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-90QVAPRLTTRRARKPKSVESGHPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, mito 6, extr 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MHFYAAALVTLLAATQVAAMPLAADSDATAVRIAKRTVAASTAAAAQPLVARAEVADEAADPADEEPEQVAPRLTTRRARKPKSVESGHPSFIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.03
12 0.03
13 0.05
14 0.05
15 0.05
16 0.06
17 0.06
18 0.08
19 0.11
20 0.11
21 0.11
22 0.13
23 0.13
24 0.13
25 0.13
26 0.13
27 0.1
28 0.11
29 0.11
30 0.1
31 0.09
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.05
54 0.07
55 0.08
56 0.08
57 0.09
58 0.08
59 0.12
60 0.17
61 0.22
62 0.29
63 0.38
64 0.48
65 0.59
66 0.65
67 0.71
68 0.76
69 0.81
70 0.82
71 0.81
72 0.78
73 0.75
74 0.74