Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8RMG8

Protein Details
Accession A0A2G8RMG8    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
289-308KSTTRKERKEYIPKPFMPKCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MWKKLFSNGLDSTPQAPKHRPLPLPNLGEGGELPGSPIPLTAIPPAFAGSWASSDSGSSASSSSPTTPASSPAPWKRTTTPYTRPPSIRAETPQYEIRSPAWHVMTTDLDKSLCRQTFTPSPEIHKPRPRRASSSHHPTPVQLMQALVSPTPAPPRALKGILKQSSTVARSAASTPAPQGPAIRVHQARLHWQLCPYDTYKSERTLRVDFDLSKPLELLVIRDVRSFGKLSRQKTDEYLHRKVCESPPLTEMNIRYSKWAGLSVTVKRADGGPILVKDVFEALYDDLNKSTTRKERKEYIPKPFMPKCEAAYRARCDASLRSVAEHRDGMRRVDMLGGESHFLGLTRPTKEDQDFWIANFGPTPPHTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.42
4 0.44
5 0.49
6 0.56
7 0.58
8 0.59
9 0.63
10 0.67
11 0.66
12 0.6
13 0.55
14 0.46
15 0.4
16 0.33
17 0.26
18 0.18
19 0.13
20 0.13
21 0.11
22 0.11
23 0.1
24 0.1
25 0.09
26 0.1
27 0.12
28 0.15
29 0.15
30 0.15
31 0.15
32 0.17
33 0.15
34 0.14
35 0.14
36 0.11
37 0.11
38 0.12
39 0.12
40 0.11
41 0.1
42 0.11
43 0.1
44 0.09
45 0.09
46 0.08
47 0.08
48 0.09
49 0.11
50 0.11
51 0.12
52 0.13
53 0.16
54 0.16
55 0.19
56 0.21
57 0.23
58 0.31
59 0.38
60 0.41
61 0.41
62 0.45
63 0.47
64 0.51
65 0.54
66 0.53
67 0.54
68 0.59
69 0.64
70 0.67
71 0.64
72 0.6
73 0.62
74 0.57
75 0.53
76 0.48
77 0.48
78 0.44
79 0.46
80 0.47
81 0.42
82 0.39
83 0.36
84 0.32
85 0.28
86 0.27
87 0.27
88 0.23
89 0.21
90 0.21
91 0.21
92 0.23
93 0.22
94 0.21
95 0.17
96 0.16
97 0.15
98 0.18
99 0.23
100 0.21
101 0.21
102 0.21
103 0.25
104 0.32
105 0.36
106 0.4
107 0.34
108 0.38
109 0.45
110 0.51
111 0.54
112 0.56
113 0.6
114 0.64
115 0.73
116 0.71
117 0.69
118 0.68
119 0.69
120 0.7
121 0.72
122 0.67
123 0.61
124 0.57
125 0.51
126 0.49
127 0.42
128 0.33
129 0.23
130 0.18
131 0.14
132 0.15
133 0.15
134 0.1
135 0.09
136 0.08
137 0.08
138 0.11
139 0.12
140 0.11
141 0.12
142 0.15
143 0.18
144 0.21
145 0.23
146 0.26
147 0.34
148 0.35
149 0.35
150 0.32
151 0.31
152 0.32
153 0.31
154 0.26
155 0.16
156 0.14
157 0.14
158 0.15
159 0.15
160 0.11
161 0.1
162 0.11
163 0.13
164 0.13
165 0.12
166 0.12
167 0.11
168 0.14
169 0.15
170 0.19
171 0.18
172 0.18
173 0.21
174 0.21
175 0.25
176 0.29
177 0.29
178 0.24
179 0.25
180 0.26
181 0.24
182 0.26
183 0.22
184 0.17
185 0.18
186 0.22
187 0.23
188 0.26
189 0.3
190 0.31
191 0.33
192 0.33
193 0.33
194 0.31
195 0.31
196 0.27
197 0.25
198 0.28
199 0.24
200 0.21
201 0.19
202 0.17
203 0.16
204 0.14
205 0.13
206 0.11
207 0.13
208 0.14
209 0.14
210 0.15
211 0.15
212 0.16
213 0.16
214 0.13
215 0.2
216 0.26
217 0.29
218 0.35
219 0.36
220 0.36
221 0.39
222 0.44
223 0.43
224 0.45
225 0.5
226 0.47
227 0.47
228 0.47
229 0.47
230 0.45
231 0.45
232 0.39
233 0.33
234 0.32
235 0.33
236 0.33
237 0.31
238 0.29
239 0.27
240 0.28
241 0.26
242 0.26
243 0.24
244 0.24
245 0.22
246 0.23
247 0.16
248 0.17
249 0.21
250 0.22
251 0.27
252 0.27
253 0.26
254 0.24
255 0.24
256 0.21
257 0.17
258 0.17
259 0.15
260 0.14
261 0.17
262 0.17
263 0.16
264 0.14
265 0.14
266 0.12
267 0.09
268 0.1
269 0.08
270 0.11
271 0.12
272 0.12
273 0.12
274 0.13
275 0.14
276 0.14
277 0.2
278 0.27
279 0.36
280 0.42
281 0.49
282 0.57
283 0.67
284 0.77
285 0.78
286 0.79
287 0.79
288 0.77
289 0.8
290 0.76
291 0.7
292 0.64
293 0.59
294 0.53
295 0.51
296 0.51
297 0.49
298 0.52
299 0.52
300 0.51
301 0.49
302 0.45
303 0.4
304 0.39
305 0.38
306 0.36
307 0.32
308 0.3
309 0.33
310 0.35
311 0.35
312 0.35
313 0.32
314 0.33
315 0.34
316 0.34
317 0.33
318 0.31
319 0.28
320 0.28
321 0.26
322 0.19
323 0.2
324 0.18
325 0.16
326 0.16
327 0.15
328 0.12
329 0.12
330 0.11
331 0.14
332 0.18
333 0.2
334 0.23
335 0.26
336 0.32
337 0.35
338 0.37
339 0.36
340 0.4
341 0.38
342 0.36
343 0.4
344 0.34
345 0.32
346 0.3
347 0.25
348 0.21