Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8RX84

Protein Details
Accession A0A2G8RX84   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-31QRTSLSPQTRRQHFRKPCPSRVLRCGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, plas 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MVSPQRTSLSPQTRRQHFRKPCPSRVLRCGAALVGSLLAFVPGIWSSPPALADDRMNGMHRRMCWRTTWKEEALLCSSAGCSDPLDRDVIQYKGDVCIPGPLPVKSHTVHYDTRLHLVAGVASG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.8
4 0.8
5 0.82
6 0.84
7 0.84
8 0.83
9 0.85
10 0.87
11 0.84
12 0.81
13 0.77
14 0.67
15 0.59
16 0.51
17 0.4
18 0.32
19 0.24
20 0.16
21 0.09
22 0.07
23 0.06
24 0.05
25 0.04
26 0.04
27 0.03
28 0.04
29 0.04
30 0.04
31 0.04
32 0.05
33 0.06
34 0.07
35 0.07
36 0.08
37 0.09
38 0.1
39 0.1
40 0.1
41 0.11
42 0.12
43 0.13
44 0.13
45 0.13
46 0.14
47 0.15
48 0.21
49 0.21
50 0.22
51 0.25
52 0.32
53 0.36
54 0.4
55 0.44
56 0.39
57 0.41
58 0.4
59 0.39
60 0.34
61 0.29
62 0.22
63 0.17
64 0.16
65 0.12
66 0.12
67 0.09
68 0.07
69 0.07
70 0.09
71 0.09
72 0.12
73 0.11
74 0.13
75 0.16
76 0.16
77 0.16
78 0.15
79 0.15
80 0.15
81 0.16
82 0.14
83 0.11
84 0.15
85 0.15
86 0.2
87 0.22
88 0.21
89 0.22
90 0.24
91 0.28
92 0.24
93 0.28
94 0.27
95 0.29
96 0.31
97 0.34
98 0.39
99 0.37
100 0.4
101 0.36
102 0.32
103 0.28
104 0.25