Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SJC2

Protein Details
Accession A0A2G8SJC2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
176-200MDFDRTGKAKQKKPKAARQFPRGSTHydrophilic
NLS Segment(s)
PositionSequence
183-193KAKQKKPKAAR
Subcellular Location(s) mito 11, cyto_nucl 8.5, cyto 7.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036890  HATPase_C_sf  
IPR038973  MutL/Mlh/Pms  
Gene Ontology GO:0032300  C:mismatch repair complex  
GO:0016887  F:ATP hydrolysis activity  
GO:0140664  F:ATP-dependent DNA damage sensor activity  
GO:0006298  P:mismatch repair  
Amino Acid Sequences MAAPFPSTSTLNNPIKVLDSASAHKIFSGQVVVDLQTAVAELVENSLDAGSTSIGAFLFLVSSSLPLPPASPYAYSPRSKAANVSRAEVRFKDYGLESFDVVDNGSGIPPKDYDYIAFLERVWEGEATSKLTSFSDLDTVTTFGFRGDALSSLCALSDVVSVTTVTAADAPAGTVMDFDRTGKAKQKKPKAARQFPRGSTVSVSGLFKPLPVRCKELECNARREHAKALALLHAYAQLSLATSPPSSSPFSMYMLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.33
4 0.29
5 0.22
6 0.21
7 0.22
8 0.27
9 0.28
10 0.25
11 0.24
12 0.23
13 0.2
14 0.18
15 0.17
16 0.11
17 0.12
18 0.13
19 0.13
20 0.13
21 0.12
22 0.1
23 0.08
24 0.08
25 0.06
26 0.05
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.05
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.05
48 0.04
49 0.05
50 0.05
51 0.06
52 0.07
53 0.06
54 0.07
55 0.08
56 0.1
57 0.11
58 0.12
59 0.14
60 0.2
61 0.26
62 0.27
63 0.27
64 0.3
65 0.31
66 0.3
67 0.34
68 0.35
69 0.37
70 0.36
71 0.38
72 0.38
73 0.38
74 0.4
75 0.34
76 0.31
77 0.24
78 0.23
79 0.22
80 0.18
81 0.18
82 0.18
83 0.18
84 0.14
85 0.14
86 0.14
87 0.12
88 0.11
89 0.09
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.08
98 0.09
99 0.09
100 0.09
101 0.11
102 0.12
103 0.12
104 0.12
105 0.1
106 0.1
107 0.1
108 0.1
109 0.08
110 0.07
111 0.06
112 0.08
113 0.09
114 0.1
115 0.1
116 0.1
117 0.09
118 0.09
119 0.1
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.09
126 0.09
127 0.08
128 0.08
129 0.07
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.06
137 0.07
138 0.07
139 0.07
140 0.07
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.06
164 0.06
165 0.07
166 0.1
167 0.12
168 0.15
169 0.23
170 0.32
171 0.38
172 0.48
173 0.58
174 0.65
175 0.73
176 0.81
177 0.83
178 0.86
179 0.88
180 0.88
181 0.86
182 0.78
183 0.76
184 0.67
185 0.57
186 0.48
187 0.41
188 0.33
189 0.27
190 0.26
191 0.2
192 0.2
193 0.19
194 0.18
195 0.21
196 0.22
197 0.27
198 0.29
199 0.34
200 0.34
201 0.41
202 0.44
203 0.49
204 0.55
205 0.53
206 0.57
207 0.55
208 0.59
209 0.55
210 0.52
211 0.48
212 0.44
213 0.42
214 0.36
215 0.36
216 0.33
217 0.32
218 0.29
219 0.24
220 0.2
221 0.18
222 0.15
223 0.14
224 0.09
225 0.09
226 0.09
227 0.1
228 0.09
229 0.09
230 0.1
231 0.11
232 0.15
233 0.18
234 0.18
235 0.21
236 0.22