Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8S956

Protein Details
Accession A0A2G8S956    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-51VEDARECEGRRRRRRRLGHAACNWKQBasic
NLS Segment(s)
PositionSequence
35-41RRRRRRR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MEITAGWQSQLSACECQRKERGYSNVEDARECEGRRRRRRRLGHAACNWKQLTPRAPGRPPYGRIPNSVQDPASFLQPTVKNHNILYTLADNSEQCRLRIYLTGPNSTLKWMMMVPSLPTVDDLPWGTEQKNFPQARSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.39
4 0.44
5 0.45
6 0.47
7 0.51
8 0.56
9 0.51
10 0.53
11 0.54
12 0.52
13 0.49
14 0.44
15 0.37
16 0.34
17 0.33
18 0.3
19 0.31
20 0.35
21 0.45
22 0.55
23 0.65
24 0.7
25 0.77
26 0.87
27 0.88
28 0.9
29 0.9
30 0.89
31 0.87
32 0.87
33 0.79
34 0.76
35 0.65
36 0.55
37 0.48
38 0.42
39 0.37
40 0.34
41 0.39
42 0.39
43 0.42
44 0.45
45 0.49
46 0.5
47 0.48
48 0.48
49 0.5
50 0.44
51 0.44
52 0.44
53 0.41
54 0.39
55 0.36
56 0.3
57 0.21
58 0.22
59 0.19
60 0.17
61 0.14
62 0.1
63 0.15
64 0.18
65 0.2
66 0.26
67 0.28
68 0.27
69 0.27
70 0.29
71 0.25
72 0.22
73 0.22
74 0.16
75 0.14
76 0.13
77 0.14
78 0.12
79 0.12
80 0.18
81 0.16
82 0.15
83 0.17
84 0.17
85 0.18
86 0.21
87 0.22
88 0.23
89 0.26
90 0.28
91 0.27
92 0.29
93 0.28
94 0.26
95 0.24
96 0.16
97 0.14
98 0.12
99 0.12
100 0.12
101 0.13
102 0.12
103 0.15
104 0.15
105 0.14
106 0.15
107 0.14
108 0.13
109 0.15
110 0.14
111 0.14
112 0.17
113 0.19
114 0.18
115 0.23
116 0.25
117 0.29
118 0.39
119 0.37