Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8S5W4

Protein Details
Accession A0A2G8S5W4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-29PDSGSAQYTNPRKRPKREPDDDTDDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
Pfam View protein in Pfam  
PF00651  BTB  
PROSITE View protein in PROSITE  
PS50097  BTB  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MADPDSGSAQYTNPRKRPKREPDDDTDDIHVDVDEKPFVNHPTLYFDDGNVILTTGRTLFCVHRSLLSKHSPAFRELFEREHGTFRDLMQILMEETPEDLEALLNVIYDGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.71
4 0.8
5 0.83
6 0.85
7 0.85
8 0.84
9 0.82
10 0.82
11 0.75
12 0.67
13 0.58
14 0.47
15 0.38
16 0.3
17 0.21
18 0.13
19 0.12
20 0.11
21 0.09
22 0.09
23 0.09
24 0.11
25 0.13
26 0.14
27 0.14
28 0.13
29 0.18
30 0.19
31 0.22
32 0.2
33 0.18
34 0.18
35 0.17
36 0.17
37 0.11
38 0.1
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.07
46 0.07
47 0.1
48 0.12
49 0.12
50 0.16
51 0.2
52 0.21
53 0.25
54 0.29
55 0.29
56 0.29
57 0.34
58 0.31
59 0.3
60 0.3
61 0.26
62 0.27
63 0.26
64 0.26
65 0.25
66 0.28
67 0.27
68 0.29
69 0.28
70 0.25
71 0.24
72 0.22
73 0.26
74 0.22
75 0.21
76 0.17
77 0.17
78 0.16
79 0.15
80 0.15
81 0.07
82 0.07
83 0.08
84 0.07
85 0.07
86 0.06
87 0.06
88 0.05
89 0.06
90 0.06
91 0.05