Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8S7T0

Protein Details
Accession A0A2G8S7T0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
163-189EKPESAAKPAKRKAKKQDKKLLSFDEDHydrophilic
NLS Segment(s)
PositionSequence
146-182KPKGSKRKAVGDGRDDAEKPESAAKPAKRKAKKQDKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSNKEPTRAQLSSRLTYQSRTPAFLLRIQNGMGGGGRDDDEDGEFEYDGSGRPPIPKRPAIPERPDDEPGSADEDDLDEKPQIVVLKEGKHLSERDVENEKRRANGLPPLPDPAENPSKNEPAKGSTSAESKALKQQGLSFGAAVKPKGSKRKAVGDGRDDAEKPESAAKPAKRKAKKQDKKLLSFDEDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.41
4 0.42
5 0.42
6 0.38
7 0.37
8 0.36
9 0.36
10 0.37
11 0.41
12 0.42
13 0.35
14 0.34
15 0.31
16 0.3
17 0.25
18 0.23
19 0.17
20 0.11
21 0.09
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.09
31 0.08
32 0.08
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.14
40 0.18
41 0.25
42 0.32
43 0.37
44 0.39
45 0.47
46 0.55
47 0.57
48 0.6
49 0.58
50 0.55
51 0.54
52 0.54
53 0.45
54 0.37
55 0.3
56 0.24
57 0.22
58 0.18
59 0.14
60 0.11
61 0.1
62 0.11
63 0.11
64 0.11
65 0.07
66 0.07
67 0.07
68 0.08
69 0.08
70 0.07
71 0.1
72 0.12
73 0.14
74 0.16
75 0.17
76 0.16
77 0.18
78 0.18
79 0.17
80 0.2
81 0.18
82 0.2
83 0.26
84 0.28
85 0.32
86 0.37
87 0.35
88 0.3
89 0.31
90 0.29
91 0.24
92 0.29
93 0.27
94 0.26
95 0.26
96 0.29
97 0.28
98 0.27
99 0.26
100 0.24
101 0.28
102 0.24
103 0.27
104 0.28
105 0.33
106 0.32
107 0.33
108 0.3
109 0.24
110 0.27
111 0.26
112 0.25
113 0.22
114 0.23
115 0.23
116 0.25
117 0.23
118 0.21
119 0.25
120 0.26
121 0.24
122 0.23
123 0.25
124 0.26
125 0.28
126 0.27
127 0.2
128 0.18
129 0.21
130 0.22
131 0.19
132 0.15
133 0.18
134 0.24
135 0.33
136 0.36
137 0.41
138 0.45
139 0.54
140 0.62
141 0.66
142 0.67
143 0.63
144 0.64
145 0.58
146 0.56
147 0.47
148 0.4
149 0.34
150 0.27
151 0.23
152 0.25
153 0.24
154 0.25
155 0.33
156 0.37
157 0.45
158 0.52
159 0.61
160 0.63
161 0.72
162 0.79
163 0.83
164 0.86
165 0.87
166 0.9
167 0.9
168 0.89
169 0.88
170 0.84