Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SMM8

Protein Details
Accession A0A2G8SMM8   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-121LRNRYNTRTRKPGKWTPFRQPKSYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, cyto 6.5, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009061  DNA-bd_dom_put_sf  
IPR037129  XPA_sf  
Gene Ontology GO:0005634  C:nucleus  
CDD cd21075  DBD_XPA-like  
Amino Acid Sequences MQSAKQVPSRLGPTPDNSSASWRESKVPEDAVISKSMAFKQYRLKPEDLDGIPFDIKPGQLGGYPCDRYLYNERDVERKAWERHGGPEGFDAYLSVLRNRYNTRTRKPGKWTPFRQPKSYDNDGDAVDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.42
4 0.38
5 0.38
6 0.36
7 0.37
8 0.36
9 0.3
10 0.32
11 0.31
12 0.33
13 0.31
14 0.3
15 0.27
16 0.26
17 0.27
18 0.23
19 0.22
20 0.2
21 0.18
22 0.18
23 0.18
24 0.2
25 0.18
26 0.2
27 0.28
28 0.35
29 0.41
30 0.44
31 0.45
32 0.4
33 0.42
34 0.46
35 0.37
36 0.32
37 0.25
38 0.22
39 0.2
40 0.19
41 0.17
42 0.1
43 0.09
44 0.07
45 0.07
46 0.06
47 0.08
48 0.09
49 0.1
50 0.14
51 0.15
52 0.14
53 0.15
54 0.15
55 0.17
56 0.23
57 0.25
58 0.25
59 0.27
60 0.28
61 0.31
62 0.32
63 0.3
64 0.28
65 0.31
66 0.29
67 0.3
68 0.34
69 0.32
70 0.34
71 0.39
72 0.34
73 0.28
74 0.28
75 0.25
76 0.2
77 0.18
78 0.15
79 0.09
80 0.12
81 0.12
82 0.11
83 0.12
84 0.13
85 0.18
86 0.21
87 0.28
88 0.35
89 0.43
90 0.49
91 0.58
92 0.64
93 0.68
94 0.74
95 0.77
96 0.78
97 0.8
98 0.8
99 0.8
100 0.85
101 0.82
102 0.8
103 0.76
104 0.73
105 0.71
106 0.71
107 0.63
108 0.55
109 0.52