Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8STY7

Protein Details
Accession A0A2G8STY7    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
82-123LDLRAKKTRAIRRRFTKHEASLKTLKQRKKDIHFPMRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
85-114RAKKTRAIRRRFTKHEASLKTLKQRKKDIH
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLAKQLTELKTELLSLRVQKIAGGSAAKLTKINTVRKSIARVLTVMNQKQRQNLREFYKNKKYLPLDLRAKKTRAIRRRFTKHEASLKTLKQRKKDIHFPMRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.45
4 0.5
5 0.45
6 0.42
7 0.42
8 0.46
9 0.43
10 0.4
11 0.39
12 0.3
13 0.26
14 0.24
15 0.21
16 0.14
17 0.15
18 0.15
19 0.17
20 0.17
21 0.16
22 0.16
23 0.16
24 0.15
25 0.14
26 0.12
27 0.09
28 0.12
29 0.13
30 0.13
31 0.13
32 0.12
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.29
44 0.27
45 0.23
46 0.26
47 0.3
48 0.28
49 0.3
50 0.31
51 0.32
52 0.37
53 0.41
54 0.39
55 0.39
56 0.43
57 0.44
58 0.48
59 0.52
60 0.55
61 0.6
62 0.61
63 0.57
64 0.58
65 0.55
66 0.54
67 0.54
68 0.55
69 0.54
70 0.56
71 0.63
72 0.61
73 0.6
74 0.57
75 0.61
76 0.62
77 0.61
78 0.63
79 0.66
80 0.71
81 0.79
82 0.82
83 0.8
84 0.79
85 0.78
86 0.79
87 0.73
88 0.69
89 0.67
90 0.65
91 0.68
92 0.67
93 0.64
94 0.62
95 0.68
96 0.71
97 0.72
98 0.77
99 0.77
100 0.81
101 0.84
102 0.81
103 0.82
104 0.81