Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8S4M8

Protein Details
Accession A0A2G8S4M8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-33FGTEWEKKMKRENKHKHKKRLLVDADVBasic
NLS Segment(s)
PositionSequence
13-26KKMKRENKHKHKKR
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MHPLRSFGTEWEKKMKRENKHKHKKRLLVDADVELHNNTKAVDEGINQKSAEGTADSMKGRSVPLNHATGSDASYPMPEIGPKTEVAEVKPSRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.62
4 0.68
5 0.76
6 0.77
7 0.83
8 0.9
9 0.91
10 0.93
11 0.92
12 0.87
13 0.87
14 0.8
15 0.75
16 0.66
17 0.58
18 0.5
19 0.41
20 0.35
21 0.24
22 0.2
23 0.14
24 0.11
25 0.09
26 0.07
27 0.06
28 0.07
29 0.07
30 0.07
31 0.15
32 0.16
33 0.17
34 0.17
35 0.16
36 0.16
37 0.15
38 0.14
39 0.07
40 0.07
41 0.07
42 0.09
43 0.09
44 0.1
45 0.1
46 0.1
47 0.1
48 0.12
49 0.13
50 0.16
51 0.19
52 0.22
53 0.22
54 0.22
55 0.22
56 0.2
57 0.2
58 0.16
59 0.13
60 0.11
61 0.11
62 0.11
63 0.1
64 0.1
65 0.1
66 0.11
67 0.13
68 0.14
69 0.15
70 0.16
71 0.2
72 0.21
73 0.22
74 0.3