Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SCH6

Protein Details
Accession A0A2G8SCH6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
350-375AFERGGHKPYVRRKLRRDRAIEEWEABasic
NLS Segment(s)
PositionSequence
361-365RRKLR
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR032466  Metal_Hydrolase  
IPR001130  TatD-like  
Gene Ontology GO:0016788  F:hydrolase activity, acting on ester bonds  
Pfam View protein in Pfam  
PF01026  TatD_DNase  
Amino Acid Sequences MDSELKEMQAVLADVPRSVLKHVIDVHCHPTDSDMGATLQVVEEMPIRICAMATRRSDQRLVADLARAQPEKVIPCFGYHPWFAHWIALEPVASKEEHYRALFLPPAPPPKQELVDAFDRLLPYLPQPTPLAEILPELFESLEAFPDAMLGEVGIDRACRIPYARPAEPPYSDYASNGGTDSPRELSPFTIPLEHQLLVLEAQLGVAVELQRNVSLHSVKAQGMTGEFFDRVYKKYGERWLRISVDLHSCGLSAQSFRDISKRHPNVFLSLSTVINSRSPAHKELIAACSPDRLLVESDFHDIRYSAPYTWNMLRTVADVKGWHVEDIWDADVPEAEWGAVRRLEENWKAFERGGHKPYVRRKLRRDRAIEEWEANNEESD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.15
5 0.16
6 0.2
7 0.17
8 0.22
9 0.3
10 0.33
11 0.37
12 0.4
13 0.45
14 0.41
15 0.41
16 0.35
17 0.31
18 0.28
19 0.24
20 0.21
21 0.16
22 0.14
23 0.14
24 0.14
25 0.12
26 0.09
27 0.08
28 0.07
29 0.07
30 0.08
31 0.09
32 0.09
33 0.1
34 0.1
35 0.1
36 0.1
37 0.12
38 0.16
39 0.22
40 0.25
41 0.3
42 0.35
43 0.39
44 0.41
45 0.4
46 0.4
47 0.37
48 0.37
49 0.33
50 0.31
51 0.29
52 0.31
53 0.34
54 0.3
55 0.25
56 0.23
57 0.25
58 0.27
59 0.26
60 0.26
61 0.21
62 0.23
63 0.26
64 0.26
65 0.27
66 0.25
67 0.25
68 0.23
69 0.26
70 0.25
71 0.23
72 0.21
73 0.18
74 0.18
75 0.17
76 0.15
77 0.12
78 0.13
79 0.12
80 0.12
81 0.11
82 0.14
83 0.16
84 0.2
85 0.2
86 0.22
87 0.21
88 0.24
89 0.26
90 0.22
91 0.24
92 0.24
93 0.31
94 0.3
95 0.31
96 0.32
97 0.33
98 0.34
99 0.31
100 0.29
101 0.25
102 0.28
103 0.27
104 0.24
105 0.22
106 0.2
107 0.18
108 0.16
109 0.13
110 0.1
111 0.16
112 0.15
113 0.16
114 0.17
115 0.17
116 0.19
117 0.19
118 0.17
119 0.11
120 0.12
121 0.1
122 0.1
123 0.09
124 0.07
125 0.06
126 0.06
127 0.07
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.03
138 0.03
139 0.03
140 0.04
141 0.03
142 0.03
143 0.04
144 0.05
145 0.05
146 0.06
147 0.07
148 0.1
149 0.18
150 0.25
151 0.26
152 0.29
153 0.33
154 0.35
155 0.35
156 0.34
157 0.29
158 0.25
159 0.24
160 0.2
161 0.17
162 0.15
163 0.14
164 0.13
165 0.1
166 0.07
167 0.08
168 0.08
169 0.09
170 0.08
171 0.09
172 0.09
173 0.1
174 0.11
175 0.12
176 0.12
177 0.11
178 0.11
179 0.13
180 0.15
181 0.14
182 0.12
183 0.11
184 0.1
185 0.09
186 0.09
187 0.07
188 0.04
189 0.04
190 0.04
191 0.03
192 0.03
193 0.03
194 0.04
195 0.04
196 0.05
197 0.05
198 0.05
199 0.06
200 0.07
201 0.08
202 0.09
203 0.09
204 0.11
205 0.13
206 0.13
207 0.14
208 0.13
209 0.11
210 0.11
211 0.12
212 0.1
213 0.09
214 0.08
215 0.08
216 0.1
217 0.11
218 0.12
219 0.15
220 0.17
221 0.17
222 0.23
223 0.32
224 0.38
225 0.4
226 0.43
227 0.45
228 0.45
229 0.44
230 0.39
231 0.34
232 0.3
233 0.28
234 0.24
235 0.19
236 0.17
237 0.15
238 0.14
239 0.12
240 0.08
241 0.07
242 0.1
243 0.11
244 0.12
245 0.17
246 0.18
247 0.24
248 0.35
249 0.4
250 0.4
251 0.44
252 0.45
253 0.44
254 0.45
255 0.39
256 0.32
257 0.27
258 0.25
259 0.2
260 0.2
261 0.16
262 0.15
263 0.16
264 0.14
265 0.17
266 0.21
267 0.23
268 0.25
269 0.26
270 0.26
271 0.28
272 0.31
273 0.27
274 0.25
275 0.22
276 0.22
277 0.2
278 0.19
279 0.16
280 0.12
281 0.13
282 0.13
283 0.15
284 0.15
285 0.19
286 0.18
287 0.18
288 0.17
289 0.15
290 0.15
291 0.17
292 0.17
293 0.15
294 0.18
295 0.2
296 0.24
297 0.28
298 0.3
299 0.26
300 0.25
301 0.25
302 0.23
303 0.25
304 0.21
305 0.19
306 0.16
307 0.17
308 0.22
309 0.22
310 0.2
311 0.17
312 0.17
313 0.17
314 0.19
315 0.18
316 0.13
317 0.12
318 0.12
319 0.12
320 0.11
321 0.1
322 0.08
323 0.06
324 0.07
325 0.08
326 0.11
327 0.12
328 0.13
329 0.14
330 0.17
331 0.26
332 0.31
333 0.34
334 0.37
335 0.39
336 0.4
337 0.39
338 0.42
339 0.39
340 0.42
341 0.42
342 0.44
343 0.46
344 0.52
345 0.62
346 0.68
347 0.72
348 0.73
349 0.8
350 0.83
351 0.89
352 0.91
353 0.89
354 0.84
355 0.83
356 0.82
357 0.76
358 0.7
359 0.62
360 0.55
361 0.5