Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8SVH9

Protein Details
Accession A0A2G8SVH9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAADKKKKKGKPSQPPSVQGSDHydrophilic
NLS Segment(s)
PositionSequence
5-12KKKKKGKP
Subcellular Location(s) cyto 12.5, cyto_nucl 11.5, nucl 9.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAADKKKKKGKPSQPPSVQGSDEDGMIVAPEVDAAVPPPLGSATVDPDPNDVEAPQPKHRYSTRAANVDRHPGKDVGLHWKESKRVLNVALVRVHGFGPEVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.8
4 0.74
5 0.63
6 0.53
7 0.48
8 0.37
9 0.28
10 0.22
11 0.16
12 0.11
13 0.1
14 0.09
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.08
31 0.1
32 0.1
33 0.1
34 0.11
35 0.11
36 0.11
37 0.11
38 0.07
39 0.08
40 0.12
41 0.16
42 0.21
43 0.24
44 0.24
45 0.29
46 0.31
47 0.33
48 0.33
49 0.39
50 0.41
51 0.45
52 0.46
53 0.48
54 0.49
55 0.55
56 0.53
57 0.45
58 0.4
59 0.33
60 0.31
61 0.28
62 0.28
63 0.28
64 0.29
65 0.3
66 0.32
67 0.35
68 0.38
69 0.4
70 0.44
71 0.37
72 0.38
73 0.36
74 0.4
75 0.4
76 0.41
77 0.38
78 0.33
79 0.3
80 0.28
81 0.26
82 0.19
83 0.17