Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8RML3

Protein Details
Accession A0A2G8RML3   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
85-110YSLPKARKCAKRELKWPSERRWRICGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MRDVDVYVYVVYDEPAVSKPYPSSPLIPSSADPPIRRREHERRTATTRAHEDSRMPISFHFSQSAPMPTRAPGWPLMSLGSRSSYSLPKARKCAKRELKWPSERRWRICG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.12
4 0.12
5 0.13
6 0.15
7 0.18
8 0.22
9 0.22
10 0.24
11 0.24
12 0.27
13 0.28
14 0.28
15 0.25
16 0.24
17 0.28
18 0.28
19 0.28
20 0.28
21 0.35
22 0.37
23 0.41
24 0.47
25 0.51
26 0.57
27 0.65
28 0.67
29 0.64
30 0.67
31 0.69
32 0.62
33 0.57
34 0.52
35 0.45
36 0.41
37 0.35
38 0.3
39 0.27
40 0.29
41 0.24
42 0.2
43 0.17
44 0.2
45 0.21
46 0.21
47 0.19
48 0.15
49 0.16
50 0.18
51 0.22
52 0.19
53 0.19
54 0.18
55 0.17
56 0.2
57 0.19
58 0.19
59 0.17
60 0.17
61 0.17
62 0.16
63 0.17
64 0.16
65 0.17
66 0.16
67 0.15
68 0.13
69 0.14
70 0.16
71 0.18
72 0.21
73 0.27
74 0.33
75 0.37
76 0.46
77 0.55
78 0.61
79 0.62
80 0.69
81 0.73
82 0.75
83 0.79
84 0.8
85 0.81
86 0.83
87 0.86
88 0.85
89 0.85
90 0.85