Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NKN0

Protein Details
Accession J3NKN0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSKSKGKGRSKRGEKPLTYTHydrophilic
NLS Segment(s)
PositionSequence
4-13SKGKGRSKRG
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MSKSKGKGRSKRGEKPLTYTSSTQAEYQDMMSTFPLETPGYTPDTSVAAGSSSAGTTPQTASSHDEGGVIRNPAIESSESIELSGPMEVDGSVKSGGSVAFYGDFSVRERIEAYGDIALQGNMTCNDRVKTMGSMRVTGDALFRSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.76
4 0.7
5 0.64
6 0.56
7 0.49
8 0.43
9 0.41
10 0.35
11 0.29
12 0.24
13 0.21
14 0.2
15 0.19
16 0.15
17 0.14
18 0.13
19 0.13
20 0.11
21 0.11
22 0.12
23 0.09
24 0.09
25 0.1
26 0.12
27 0.14
28 0.14
29 0.14
30 0.13
31 0.14
32 0.14
33 0.12
34 0.1
35 0.06
36 0.06
37 0.07
38 0.06
39 0.05
40 0.04
41 0.05
42 0.05
43 0.05
44 0.06
45 0.08
46 0.09
47 0.1
48 0.14
49 0.15
50 0.16
51 0.15
52 0.15
53 0.13
54 0.14
55 0.15
56 0.11
57 0.09
58 0.09
59 0.09
60 0.08
61 0.09
62 0.07
63 0.06
64 0.08
65 0.1
66 0.09
67 0.09
68 0.09
69 0.08
70 0.08
71 0.08
72 0.05
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.06
88 0.06
89 0.07
90 0.07
91 0.08
92 0.09
93 0.13
94 0.12
95 0.12
96 0.13
97 0.13
98 0.15
99 0.15
100 0.14
101 0.12
102 0.12
103 0.12
104 0.11
105 0.1
106 0.09
107 0.08
108 0.08
109 0.09
110 0.11
111 0.12
112 0.14
113 0.15
114 0.16
115 0.18
116 0.19
117 0.23
118 0.25
119 0.31
120 0.3
121 0.31
122 0.32
123 0.33
124 0.31
125 0.26
126 0.24