Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PLI0

Protein Details
Accession J3PLI0    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-117WLETRERKPQSRKCISHQADHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 11, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004181  Znf_MIZ  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF02891  zf-MIZ  
PROSITE View protein in PROSITE  
PS51044  ZF_SP_RING  
Amino Acid Sequences MLRVPVEYYAIAVEIIITKSHSSLWNQIRNDQVIPPEKTLEVIRKRISVNNDNDDDSIMVVTEELPIDLADPFSAIMFETPVRGATCTHLECFDLSNWLETRERKPQSRKCISHQADMAVSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.08
6 0.09
7 0.12
8 0.14
9 0.15
10 0.24
11 0.32
12 0.39
13 0.4
14 0.44
15 0.45
16 0.45
17 0.43
18 0.36
19 0.33
20 0.33
21 0.34
22 0.31
23 0.29
24 0.26
25 0.26
26 0.27
27 0.29
28 0.27
29 0.31
30 0.31
31 0.33
32 0.35
33 0.37
34 0.42
35 0.41
36 0.42
37 0.41
38 0.41
39 0.38
40 0.37
41 0.33
42 0.26
43 0.18
44 0.12
45 0.06
46 0.05
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.03
58 0.04
59 0.04
60 0.03
61 0.04
62 0.03
63 0.03
64 0.04
65 0.05
66 0.05
67 0.05
68 0.07
69 0.07
70 0.08
71 0.09
72 0.11
73 0.16
74 0.17
75 0.18
76 0.17
77 0.17
78 0.17
79 0.19
80 0.16
81 0.14
82 0.13
83 0.16
84 0.16
85 0.18
86 0.22
87 0.23
88 0.29
89 0.35
90 0.42
91 0.47
92 0.57
93 0.64
94 0.71
95 0.79
96 0.79
97 0.77
98 0.81
99 0.77
100 0.75
101 0.69
102 0.62