Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8S431

Protein Details
Accession A0A2G8S431    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-43AAFFILRRARRRARRASVDSARWHydrophilic
NLS Segment(s)
PositionSequence
28-35RARRRARR
Subcellular Location(s) extr 13, plas 5, mito 4, pero 2, golg 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAILGIVFGVLSVLLCIFFAAFFILRRARRRARRASVDSARWHLRPHSYDSDDSSSRVISSVWTWTGSMSADSHFESRHEPSMHSLDFKFGDLEKDASPHDPHSYAPSPCPSPSPSPDPRWAETQPLTHDAPFMPQLQPPPHPHPNPHHDIPHLAVPSSPAIHASSSSELLTLAGTDFTGARLLGGHDSGLGRSVSGVSHATASSGYVQSVEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.06
9 0.06
10 0.07
11 0.12
12 0.19
13 0.24
14 0.3
15 0.39
16 0.48
17 0.57
18 0.66
19 0.73
20 0.76
21 0.81
22 0.82
23 0.83
24 0.82
25 0.78
26 0.73
27 0.69
28 0.63
29 0.54
30 0.49
31 0.43
32 0.42
33 0.38
34 0.41
35 0.42
36 0.42
37 0.42
38 0.45
39 0.46
40 0.4
41 0.38
42 0.31
43 0.23
44 0.19
45 0.18
46 0.13
47 0.08
48 0.09
49 0.11
50 0.11
51 0.11
52 0.11
53 0.11
54 0.12
55 0.11
56 0.11
57 0.08
58 0.08
59 0.09
60 0.1
61 0.11
62 0.1
63 0.11
64 0.13
65 0.14
66 0.2
67 0.19
68 0.19
69 0.22
70 0.26
71 0.25
72 0.25
73 0.22
74 0.19
75 0.18
76 0.18
77 0.15
78 0.11
79 0.12
80 0.11
81 0.13
82 0.11
83 0.11
84 0.11
85 0.13
86 0.13
87 0.13
88 0.13
89 0.12
90 0.12
91 0.17
92 0.2
93 0.18
94 0.19
95 0.2
96 0.2
97 0.2
98 0.22
99 0.19
100 0.19
101 0.22
102 0.28
103 0.31
104 0.34
105 0.42
106 0.43
107 0.42
108 0.44
109 0.41
110 0.38
111 0.35
112 0.34
113 0.28
114 0.28
115 0.27
116 0.22
117 0.22
118 0.17
119 0.17
120 0.16
121 0.15
122 0.12
123 0.13
124 0.17
125 0.19
126 0.24
127 0.28
128 0.35
129 0.41
130 0.43
131 0.47
132 0.51
133 0.56
134 0.58
135 0.56
136 0.51
137 0.43
138 0.43
139 0.4
140 0.38
141 0.3
142 0.23
143 0.19
144 0.18
145 0.18
146 0.17
147 0.14
148 0.1
149 0.1
150 0.11
151 0.11
152 0.12
153 0.13
154 0.13
155 0.13
156 0.12
157 0.11
158 0.11
159 0.1
160 0.08
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.06
168 0.06
169 0.06
170 0.06
171 0.08
172 0.09
173 0.09
174 0.08
175 0.09
176 0.1
177 0.1
178 0.11
179 0.1
180 0.09
181 0.09
182 0.09
183 0.08
184 0.1
185 0.11
186 0.09
187 0.11
188 0.11
189 0.11
190 0.11
191 0.12
192 0.13
193 0.13
194 0.12
195 0.11