Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8S718

Protein Details
Accession A0A2G8S718   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
112-133YKSVNDLKKLNKNKKLAKQYDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
Amino Acid Sequences MSRFGRGFGSTKRTVGHRDTMVGEQQNRGAKQRRKGGGKDVHDAMLLAVFNIRPVDETVIVGDGGLVELELLASSNGDKRRNFVKTIELQIGLKNYDPQRDKCFSGVIDLEYKSVNDLKKLNKNKKLAKQYDAFLASKALIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.42
4 0.36
5 0.36
6 0.37
7 0.38
8 0.4
9 0.39
10 0.35
11 0.29
12 0.32
13 0.35
14 0.33
15 0.37
16 0.41
17 0.43
18 0.5
19 0.58
20 0.61
21 0.63
22 0.65
23 0.68
24 0.67
25 0.65
26 0.62
27 0.55
28 0.47
29 0.4
30 0.36
31 0.26
32 0.18
33 0.13
34 0.08
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.06
42 0.09
43 0.08
44 0.09
45 0.08
46 0.09
47 0.09
48 0.07
49 0.06
50 0.04
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.07
63 0.1
64 0.15
65 0.15
66 0.17
67 0.24
68 0.27
69 0.29
70 0.27
71 0.31
72 0.31
73 0.35
74 0.35
75 0.3
76 0.27
77 0.27
78 0.26
79 0.2
80 0.16
81 0.17
82 0.17
83 0.23
84 0.27
85 0.29
86 0.35
87 0.38
88 0.39
89 0.35
90 0.36
91 0.29
92 0.29
93 0.26
94 0.21
95 0.21
96 0.2
97 0.19
98 0.17
99 0.17
100 0.15
101 0.18
102 0.16
103 0.17
104 0.22
105 0.29
106 0.39
107 0.5
108 0.58
109 0.63
110 0.72
111 0.78
112 0.83
113 0.86
114 0.83
115 0.79
116 0.74
117 0.68
118 0.67
119 0.62
120 0.52
121 0.41
122 0.36