Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8S1V5

Protein Details
Accession A0A2G8S1V5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
78-100GFGGSDSKQKPKPKPKHHRDLRSBasic
NLS Segment(s)
PositionSequence
85-99KQKPKPKPKHHRDLR
Subcellular Location(s) extr 13, mito 5, E.R. 4, golg 3
Family & Domain DBs
Amino Acid Sequences MRFSVIVFALALVNFAAAAALPRAEAEESTEIETLVARGKQDIGGLCSGDSECITGCCDFRMGECASHTIASKFGGCGFGGSDSKQKPKPKPKHHRDLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.03
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.06
11 0.06
12 0.06
13 0.09
14 0.11
15 0.12
16 0.14
17 0.14
18 0.13
19 0.12
20 0.12
21 0.09
22 0.1
23 0.09
24 0.07
25 0.08
26 0.08
27 0.09
28 0.1
29 0.11
30 0.1
31 0.1
32 0.1
33 0.09
34 0.09
35 0.09
36 0.07
37 0.06
38 0.05
39 0.04
40 0.04
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.07
48 0.11
49 0.11
50 0.12
51 0.12
52 0.14
53 0.14
54 0.15
55 0.15
56 0.11
57 0.11
58 0.11
59 0.11
60 0.1
61 0.1
62 0.11
63 0.1
64 0.1
65 0.1
66 0.12
67 0.13
68 0.14
69 0.21
70 0.23
71 0.31
72 0.37
73 0.45
74 0.53
75 0.62
76 0.72
77 0.76
78 0.84
79 0.88
80 0.92