Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SA66

Protein Details
Accession A0A2G8SA66    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-84IMKNSSCKKRSEKKTRSGSIRLPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MAIDVDTPGGLCVELVIPVLWAPGLNRGGQAELRSASKADTVTAQASLLPSVCFKKEADYGIMKNSSCKKRSEKKTRSGSIRLPTVIVPPSRDRHSAMKAPLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.05
4 0.05
5 0.05
6 0.06
7 0.05
8 0.05
9 0.05
10 0.1
11 0.12
12 0.12
13 0.13
14 0.13
15 0.15
16 0.16
17 0.16
18 0.12
19 0.13
20 0.13
21 0.13
22 0.13
23 0.12
24 0.13
25 0.12
26 0.1
27 0.1
28 0.1
29 0.1
30 0.1
31 0.1
32 0.08
33 0.08
34 0.08
35 0.07
36 0.06
37 0.06
38 0.07
39 0.08
40 0.09
41 0.08
42 0.11
43 0.13
44 0.15
45 0.17
46 0.19
47 0.19
48 0.22
49 0.24
50 0.21
51 0.23
52 0.31
53 0.34
54 0.33
55 0.38
56 0.44
57 0.52
58 0.64
59 0.7
60 0.71
61 0.74
62 0.83
63 0.85
64 0.84
65 0.8
66 0.76
67 0.72
68 0.67
69 0.58
70 0.49
71 0.41
72 0.37
73 0.35
74 0.29
75 0.27
76 0.28
77 0.33
78 0.36
79 0.37
80 0.38
81 0.41
82 0.46
83 0.49
84 0.48