Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8RVT4

Protein Details
Accession A0A2G8RVT4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-63SSSPYGRTHVWKRRQRKLPNPMVPVFHydrophilic
NLS Segment(s)
PositionSequence
157-161GKTKS
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MLGLASTVAPRSLASSSTSGVAALSPFARLQIQTRAVSSSPYGRTHVWKRRQRKLPNPMVPVFPQRLVRVDGSTIIHWTTSPRSVIRLTRDTTNNPLWNAARFVGMDEEEDEVTGRMGRFSRRFADLGGQKADLDMDWLNEVDGAEGEVVEGGKEKGKTKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.16
5 0.16
6 0.14
7 0.13
8 0.12
9 0.09
10 0.08
11 0.08
12 0.08
13 0.07
14 0.09
15 0.1
16 0.1
17 0.13
18 0.19
19 0.24
20 0.24
21 0.25
22 0.27
23 0.26
24 0.27
25 0.25
26 0.24
27 0.23
28 0.24
29 0.26
30 0.25
31 0.32
32 0.41
33 0.49
34 0.53
35 0.58
36 0.65
37 0.73
38 0.81
39 0.84
40 0.85
41 0.86
42 0.86
43 0.86
44 0.82
45 0.74
46 0.67
47 0.59
48 0.53
49 0.44
50 0.36
51 0.3
52 0.24
53 0.25
54 0.24
55 0.22
56 0.19
57 0.17
58 0.16
59 0.15
60 0.14
61 0.13
62 0.1
63 0.09
64 0.08
65 0.09
66 0.09
67 0.1
68 0.11
69 0.1
70 0.12
71 0.15
72 0.18
73 0.22
74 0.25
75 0.25
76 0.29
77 0.31
78 0.32
79 0.35
80 0.37
81 0.34
82 0.3
83 0.31
84 0.27
85 0.25
86 0.24
87 0.19
88 0.15
89 0.12
90 0.12
91 0.11
92 0.11
93 0.1
94 0.09
95 0.1
96 0.09
97 0.09
98 0.08
99 0.07
100 0.07
101 0.08
102 0.07
103 0.08
104 0.09
105 0.15
106 0.18
107 0.22
108 0.25
109 0.27
110 0.28
111 0.27
112 0.35
113 0.33
114 0.35
115 0.33
116 0.31
117 0.27
118 0.26
119 0.25
120 0.16
121 0.14
122 0.1
123 0.09
124 0.09
125 0.09
126 0.09
127 0.1
128 0.1
129 0.08
130 0.07
131 0.07
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.06
139 0.07
140 0.11
141 0.14
142 0.18