Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8S9R4

Protein Details
Accession A0A2G8S9R4   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-43ASAERKACKRPSLRSRIRCRRRKPLRHGGMKGCIBasic
NLS Segment(s)
PositionSequence
18-37KRPSLRSRIRCRRRKPLRHG
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSNAGSSESASAERKACKRPSLRSRIRCRRRKPLRHGGMKGCITSRNRTSKSPGSSTAKTMDTSVCWGSENDASKRPYAVWGQTWRYVLASFGSATLLRTSTWSLISSQSHAPRMLRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.43
4 0.49
5 0.54
6 0.62
7 0.69
8 0.74
9 0.79
10 0.81
11 0.87
12 0.89
13 0.92
14 0.92
15 0.9
16 0.9
17 0.9
18 0.91
19 0.9
20 0.9
21 0.89
22 0.89
23 0.87
24 0.82
25 0.78
26 0.69
27 0.6
28 0.5
29 0.45
30 0.38
31 0.37
32 0.38
33 0.39
34 0.4
35 0.41
36 0.47
37 0.48
38 0.5
39 0.47
40 0.46
41 0.43
42 0.42
43 0.41
44 0.38
45 0.32
46 0.27
47 0.25
48 0.19
49 0.13
50 0.14
51 0.13
52 0.1
53 0.1
54 0.09
55 0.1
56 0.13
57 0.17
58 0.17
59 0.22
60 0.23
61 0.23
62 0.23
63 0.22
64 0.22
65 0.21
66 0.22
67 0.23
68 0.28
69 0.32
70 0.35
71 0.35
72 0.32
73 0.3
74 0.27
75 0.22
76 0.16
77 0.13
78 0.1
79 0.09
80 0.1
81 0.09
82 0.1
83 0.1
84 0.1
85 0.09
86 0.11
87 0.13
88 0.13
89 0.14
90 0.14
91 0.14
92 0.19
93 0.21
94 0.22
95 0.28
96 0.31
97 0.33
98 0.35