Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8SHB3

Protein Details
Accession A0A2G8SHB3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-71RVLTTAPKKPPAKRRKGRTPTARAATHydrophilic
NLS Segment(s)
PositionSequence
52-67PKKPPAKRRKGRTPTA
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MADDSLPTPAGRTNDTVHTPPMLVQTPQNRLNHTESRVVFGAPPPRVLTTAPKKPPAKRRKGRTPTARAATAVSNKNNGVGKAKTQPIRAKDSESSQSDVLTTQSLAAAEQQPVMPTSLVLGRAKRVRVATARALDQSPDMSAANKLKRRTDAISGDAGEGADQAEEVEHRVKRRNTGSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.32
4 0.3
5 0.29
6 0.27
7 0.26
8 0.27
9 0.24
10 0.21
11 0.24
12 0.3
13 0.35
14 0.41
15 0.42
16 0.4
17 0.42
18 0.48
19 0.48
20 0.44
21 0.45
22 0.39
23 0.41
24 0.39
25 0.35
26 0.29
27 0.27
28 0.31
29 0.24
30 0.26
31 0.23
32 0.23
33 0.24
34 0.24
35 0.3
36 0.31
37 0.4
38 0.43
39 0.5
40 0.55
41 0.62
42 0.71
43 0.72
44 0.75
45 0.75
46 0.8
47 0.83
48 0.86
49 0.88
50 0.88
51 0.86
52 0.83
53 0.78
54 0.69
55 0.58
56 0.51
57 0.44
58 0.4
59 0.35
60 0.28
61 0.25
62 0.24
63 0.26
64 0.26
65 0.23
66 0.21
67 0.17
68 0.19
69 0.22
70 0.27
71 0.27
72 0.31
73 0.35
74 0.35
75 0.41
76 0.39
77 0.38
78 0.34
79 0.35
80 0.36
81 0.33
82 0.31
83 0.24
84 0.23
85 0.19
86 0.18
87 0.15
88 0.09
89 0.07
90 0.05
91 0.06
92 0.05
93 0.05
94 0.07
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.1
102 0.08
103 0.06
104 0.07
105 0.08
106 0.11
107 0.12
108 0.12
109 0.16
110 0.2
111 0.21
112 0.24
113 0.23
114 0.26
115 0.28
116 0.32
117 0.34
118 0.34
119 0.35
120 0.34
121 0.33
122 0.29
123 0.25
124 0.21
125 0.14
126 0.12
127 0.11
128 0.1
129 0.14
130 0.2
131 0.27
132 0.31
133 0.35
134 0.38
135 0.42
136 0.46
137 0.47
138 0.48
139 0.45
140 0.43
141 0.44
142 0.4
143 0.37
144 0.32
145 0.27
146 0.19
147 0.14
148 0.11
149 0.06
150 0.05
151 0.04
152 0.04
153 0.05
154 0.08
155 0.14
156 0.16
157 0.21
158 0.3
159 0.34
160 0.42