Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8S281

Protein Details
Accession A0A2G8S281   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-39EPLPPLPKQSRRHKPLGPPPGSHydrophilic
187-211LGQSRKAQKQDKRAARKAQRRGETHHydrophilic
NLS Segment(s)
PositionSequence
148-156IKKRKIAKK
192-207KAQKQDKRAARKAQRR
Subcellular Location(s) nucl 7, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR028018  DUF4646  
Pfam View protein in Pfam  
PF15496  DUF4646  
Amino Acid Sequences MQDVPPRDYGARPATGNEPLPPLPKQSRRHKPLGPPPGSPAAMLDPPPACFQRGPAPNLSYPPFEPIDVYALKKDLTGGFGSEMPLNPALGYPHPFATHDVALEDWALFTKNVQQAGSLTTGEKVRAHVVGPAIGLAFFPAFLIARAIKKRKIAKKEEPVRELIYHWNVRYFHPRSMHVSLLGPEGLGQSRKAQKQDKRAARKAQRRGETHYGHADYGYAGPSDAGAGSSFPSDGGNGGKWCLRIRYQPQGYQSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.36
4 0.31
5 0.31
6 0.29
7 0.32
8 0.3
9 0.34
10 0.38
11 0.45
12 0.53
13 0.59
14 0.68
15 0.72
16 0.79
17 0.79
18 0.8
19 0.82
20 0.83
21 0.77
22 0.68
23 0.66
24 0.64
25 0.56
26 0.46
27 0.37
28 0.29
29 0.27
30 0.25
31 0.24
32 0.18
33 0.19
34 0.22
35 0.22
36 0.2
37 0.18
38 0.2
39 0.26
40 0.31
41 0.33
42 0.35
43 0.38
44 0.37
45 0.41
46 0.41
47 0.35
48 0.29
49 0.3
50 0.25
51 0.21
52 0.2
53 0.17
54 0.19
55 0.17
56 0.18
57 0.15
58 0.15
59 0.15
60 0.14
61 0.15
62 0.11
63 0.12
64 0.11
65 0.1
66 0.11
67 0.11
68 0.12
69 0.12
70 0.11
71 0.11
72 0.11
73 0.1
74 0.09
75 0.08
76 0.09
77 0.09
78 0.12
79 0.12
80 0.13
81 0.13
82 0.14
83 0.16
84 0.17
85 0.16
86 0.13
87 0.12
88 0.11
89 0.11
90 0.1
91 0.08
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.1
98 0.12
99 0.14
100 0.14
101 0.14
102 0.14
103 0.16
104 0.17
105 0.11
106 0.09
107 0.1
108 0.1
109 0.11
110 0.11
111 0.1
112 0.1
113 0.1
114 0.1
115 0.1
116 0.1
117 0.1
118 0.09
119 0.08
120 0.07
121 0.06
122 0.06
123 0.04
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.05
131 0.06
132 0.1
133 0.16
134 0.2
135 0.23
136 0.3
137 0.38
138 0.45
139 0.53
140 0.59
141 0.63
142 0.71
143 0.78
144 0.79
145 0.73
146 0.68
147 0.62
148 0.53
149 0.45
150 0.4
151 0.36
152 0.31
153 0.28
154 0.3
155 0.28
156 0.3
157 0.38
158 0.35
159 0.34
160 0.35
161 0.37
162 0.39
163 0.42
164 0.4
165 0.32
166 0.31
167 0.26
168 0.24
169 0.21
170 0.14
171 0.11
172 0.11
173 0.11
174 0.1
175 0.1
176 0.15
177 0.22
178 0.27
179 0.33
180 0.41
181 0.47
182 0.57
183 0.67
184 0.71
185 0.74
186 0.79
187 0.82
188 0.84
189 0.87
190 0.86
191 0.85
192 0.83
193 0.77
194 0.77
195 0.76
196 0.69
197 0.64
198 0.62
199 0.55
200 0.46
201 0.42
202 0.33
203 0.25
204 0.22
205 0.18
206 0.1
207 0.08
208 0.07
209 0.07
210 0.08
211 0.07
212 0.06
213 0.05
214 0.06
215 0.06
216 0.07
217 0.07
218 0.07
219 0.07
220 0.07
221 0.08
222 0.1
223 0.13
224 0.13
225 0.15
226 0.18
227 0.2
228 0.23
229 0.27
230 0.29
231 0.35
232 0.42
233 0.51
234 0.56
235 0.6
236 0.63