Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8RP17

Protein Details
Accession A0A2G8RP17    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
170-208TGTGTRPTSRRSRRKAVACRRWRSTRRARSSRSVRRGTLHydrophilic
NLS Segment(s)
PositionSequence
175-213RPTSRRSRRKAVACRRWRSTRRARSSRSVRRGTLTPPRR
Subcellular Location(s) nucl 8, cyto 8, cyto_nucl 8, extr 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Amino Acid Sequences MPAITEGTVLVTGANGFVAGWIVKDLLEHGFTVRATVRSLDKADKLKGVLASAHGDRLQFVVVDDFTAVRSLSCRRSCRPTRSLTYDCTSRTARSTRPSRASTESCTPPLPSAPPPTTPTSSLFPPSGASPASSPPPTSPRRPSSASSSCPPSPPSSTRGGARPRTCGRTGTGTRPTSRRSRRKAVACRRWRSTRRARSSRSVRRGTLTPPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.05
8 0.06
9 0.06
10 0.06
11 0.06
12 0.08
13 0.09
14 0.1
15 0.09
16 0.1
17 0.12
18 0.12
19 0.14
20 0.15
21 0.14
22 0.14
23 0.17
24 0.19
25 0.2
26 0.24
27 0.26
28 0.29
29 0.33
30 0.34
31 0.34
32 0.32
33 0.31
34 0.29
35 0.26
36 0.21
37 0.18
38 0.19
39 0.17
40 0.18
41 0.16
42 0.15
43 0.14
44 0.14
45 0.12
46 0.09
47 0.09
48 0.08
49 0.07
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.05
57 0.07
58 0.1
59 0.18
60 0.25
61 0.29
62 0.32
63 0.42
64 0.5
65 0.57
66 0.6
67 0.6
68 0.6
69 0.64
70 0.63
71 0.57
72 0.53
73 0.48
74 0.42
75 0.39
76 0.33
77 0.26
78 0.27
79 0.26
80 0.26
81 0.31
82 0.37
83 0.39
84 0.45
85 0.46
86 0.46
87 0.48
88 0.47
89 0.43
90 0.42
91 0.38
92 0.33
93 0.31
94 0.28
95 0.22
96 0.21
97 0.19
98 0.15
99 0.19
100 0.19
101 0.21
102 0.24
103 0.27
104 0.28
105 0.27
106 0.27
107 0.24
108 0.24
109 0.23
110 0.2
111 0.17
112 0.16
113 0.15
114 0.13
115 0.11
116 0.1
117 0.09
118 0.11
119 0.14
120 0.13
121 0.14
122 0.15
123 0.22
124 0.25
125 0.31
126 0.37
127 0.39
128 0.44
129 0.47
130 0.47
131 0.49
132 0.52
133 0.5
134 0.46
135 0.47
136 0.43
137 0.42
138 0.41
139 0.35
140 0.34
141 0.32
142 0.32
143 0.31
144 0.33
145 0.34
146 0.39
147 0.44
148 0.47
149 0.47
150 0.52
151 0.52
152 0.55
153 0.54
154 0.49
155 0.44
156 0.45
157 0.46
158 0.46
159 0.5
160 0.48
161 0.51
162 0.53
163 0.55
164 0.56
165 0.63
166 0.65
167 0.65
168 0.71
169 0.75
170 0.81
171 0.87
172 0.88
173 0.88
174 0.88
175 0.89
176 0.87
177 0.88
178 0.85
179 0.84
180 0.84
181 0.84
182 0.84
183 0.86
184 0.84
185 0.84
186 0.89
187 0.89
188 0.88
189 0.85
190 0.77
191 0.72
192 0.69
193 0.67