Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G8S789

Protein Details
Accession A0A2G8S789    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-65GCTRHFTRERDQKRHIKKDHBasic
NLS Segment(s)
PositionSequence
81-90KRKGLPRKTR
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MTSHPGSSVGPAKVVPTPIKERFGNFWDHWDTHNPHRQRFNCDWPGCTRHFTRERDQKRHIKKDHLYEQDQLKRGTTGSQKRKGLPRKTRAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.23
4 0.3
5 0.33
6 0.39
7 0.38
8 0.39
9 0.4
10 0.39
11 0.41
12 0.33
13 0.34
14 0.34
15 0.33
16 0.32
17 0.34
18 0.36
19 0.36
20 0.44
21 0.41
22 0.42
23 0.5
24 0.51
25 0.52
26 0.54
27 0.55
28 0.56
29 0.54
30 0.52
31 0.47
32 0.48
33 0.42
34 0.39
35 0.31
36 0.3
37 0.37
38 0.39
39 0.44
40 0.51
41 0.58
42 0.63
43 0.71
44 0.72
45 0.75
46 0.81
47 0.77
48 0.77
49 0.74
50 0.76
51 0.77
52 0.74
53 0.67
54 0.62
55 0.66
56 0.63
57 0.61
58 0.51
59 0.43
60 0.36
61 0.33
62 0.35
63 0.35
64 0.38
65 0.45
66 0.53
67 0.57
68 0.63
69 0.73
70 0.77
71 0.78
72 0.78