Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G8SUV7

Protein Details
Accession A0A2G8SUV7   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
66-97HIAERKKERRAAEKERKKEKRREYAQKRDAGEBasic
NLS Segment(s)
PositionSequence
55-89KKAQKKLAKAAHIAERKKERRAAEKERKKEKRREY
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR028564  MT_TRM10-typ  
IPR038459  MT_TRM10-typ_sf  
IPR007356  tRNA_m1G_MeTrfase_euk  
IPR016009  tRNA_MeTrfase_TRMD/TRM10  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01746  tRNA_m1G_MT  
PROSITE View protein in PROSITE  
PS51675  SAM_MT_TRM10  
CDD cd18089  SPOUT_Trm10-like  
Amino Acid Sequences MSDGVSSDAPAPTADAPKLPPLHKSDAPDRTIETDPTAASTDADASTSAAEPLSKKAQKKLAKAAHIAERKKERRAAEKERKKEKRREYAQKRDAGELDADELEREGERKRQKTEGGSGRRTAFGARVVVDLGFDAKMTENEVKSLTSQLAYTYSANRKAAQQFSSLLFTSLDGRTKERMDGMNNAAYKRWAGAEWWEEGYERLWEGKEDSGEGTVEMKVEGEDWKECTEAGGGEGKETLVKRQIRQPSRAEKSTVVYLTADSEEELSELKEGETYILGGIVDHNRYKNLCLNKSKEHGIRSARLPIGTYLTEMRTRKVLTVNQTFEILLKWVETRDWEQALNSVMPKRKFNTECRRRGGAASSRDAESVLENGVVDGEGEEVDGGGDAEVVHVAELEGNVAEDRQEDVGSSVEKES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.27
5 0.34
6 0.33
7 0.36
8 0.38
9 0.45
10 0.47
11 0.51
12 0.54
13 0.56
14 0.57
15 0.53
16 0.49
17 0.46
18 0.45
19 0.39
20 0.33
21 0.26
22 0.24
23 0.24
24 0.23
25 0.18
26 0.16
27 0.15
28 0.14
29 0.12
30 0.13
31 0.11
32 0.09
33 0.1
34 0.1
35 0.1
36 0.08
37 0.09
38 0.1
39 0.15
40 0.24
41 0.29
42 0.32
43 0.39
44 0.49
45 0.55
46 0.62
47 0.67
48 0.66
49 0.67
50 0.68
51 0.66
52 0.66
53 0.67
54 0.62
55 0.6
56 0.63
57 0.61
58 0.64
59 0.64
60 0.61
61 0.63
62 0.69
63 0.72
64 0.73
65 0.78
66 0.81
67 0.86
68 0.91
69 0.9
70 0.9
71 0.9
72 0.89
73 0.9
74 0.91
75 0.91
76 0.91
77 0.9
78 0.87
79 0.79
80 0.72
81 0.62
82 0.53
83 0.43
84 0.32
85 0.26
86 0.19
87 0.16
88 0.12
89 0.11
90 0.09
91 0.08
92 0.09
93 0.09
94 0.16
95 0.25
96 0.3
97 0.34
98 0.39
99 0.43
100 0.48
101 0.56
102 0.58
103 0.59
104 0.58
105 0.58
106 0.54
107 0.5
108 0.45
109 0.36
110 0.28
111 0.22
112 0.19
113 0.16
114 0.15
115 0.14
116 0.14
117 0.13
118 0.11
119 0.08
120 0.06
121 0.05
122 0.05
123 0.06
124 0.06
125 0.09
126 0.12
127 0.11
128 0.13
129 0.13
130 0.13
131 0.13
132 0.15
133 0.12
134 0.09
135 0.09
136 0.09
137 0.1
138 0.11
139 0.11
140 0.16
141 0.2
142 0.24
143 0.25
144 0.25
145 0.29
146 0.32
147 0.35
148 0.31
149 0.29
150 0.26
151 0.27
152 0.29
153 0.24
154 0.19
155 0.15
156 0.14
157 0.15
158 0.14
159 0.16
160 0.14
161 0.16
162 0.18
163 0.19
164 0.19
165 0.19
166 0.2
167 0.19
168 0.22
169 0.23
170 0.25
171 0.25
172 0.25
173 0.22
174 0.2
175 0.17
176 0.14
177 0.11
178 0.07
179 0.07
180 0.1
181 0.12
182 0.13
183 0.13
184 0.13
185 0.13
186 0.13
187 0.13
188 0.09
189 0.08
190 0.07
191 0.06
192 0.06
193 0.08
194 0.09
195 0.08
196 0.08
197 0.08
198 0.08
199 0.08
200 0.08
201 0.07
202 0.06
203 0.06
204 0.06
205 0.05
206 0.05
207 0.05
208 0.06
209 0.06
210 0.07
211 0.08
212 0.09
213 0.09
214 0.09
215 0.08
216 0.08
217 0.07
218 0.07
219 0.1
220 0.09
221 0.1
222 0.1
223 0.09
224 0.11
225 0.11
226 0.12
227 0.15
228 0.18
229 0.2
230 0.27
231 0.37
232 0.4
233 0.46
234 0.52
235 0.55
236 0.59
237 0.6
238 0.55
239 0.47
240 0.45
241 0.43
242 0.35
243 0.26
244 0.2
245 0.17
246 0.16
247 0.14
248 0.12
249 0.07
250 0.07
251 0.06
252 0.06
253 0.07
254 0.05
255 0.05
256 0.05
257 0.05
258 0.05
259 0.05
260 0.06
261 0.05
262 0.06
263 0.05
264 0.05
265 0.05
266 0.05
267 0.06
268 0.08
269 0.11
270 0.12
271 0.13
272 0.15
273 0.15
274 0.18
275 0.23
276 0.29
277 0.34
278 0.41
279 0.46
280 0.51
281 0.54
282 0.59
283 0.57
284 0.52
285 0.51
286 0.48
287 0.48
288 0.44
289 0.47
290 0.41
291 0.37
292 0.35
293 0.29
294 0.28
295 0.23
296 0.21
297 0.16
298 0.17
299 0.23
300 0.23
301 0.23
302 0.24
303 0.24
304 0.25
305 0.29
306 0.32
307 0.34
308 0.43
309 0.45
310 0.41
311 0.41
312 0.38
313 0.33
314 0.28
315 0.21
316 0.12
317 0.1
318 0.09
319 0.09
320 0.1
321 0.13
322 0.16
323 0.2
324 0.22
325 0.21
326 0.21
327 0.23
328 0.25
329 0.23
330 0.23
331 0.24
332 0.28
333 0.31
334 0.35
335 0.36
336 0.44
337 0.47
338 0.55
339 0.61
340 0.65
341 0.72
342 0.74
343 0.76
344 0.69
345 0.66
346 0.64
347 0.61
348 0.57
349 0.54
350 0.49
351 0.45
352 0.43
353 0.4
354 0.31
355 0.24
356 0.18
357 0.13
358 0.1
359 0.09
360 0.09
361 0.09
362 0.08
363 0.07
364 0.05
365 0.05
366 0.05
367 0.05
368 0.05
369 0.04
370 0.04
371 0.04
372 0.04
373 0.04
374 0.04
375 0.04
376 0.04
377 0.05
378 0.05
379 0.04
380 0.04
381 0.04
382 0.05
383 0.05
384 0.06
385 0.06
386 0.06
387 0.07
388 0.07
389 0.07
390 0.07
391 0.09
392 0.09
393 0.09
394 0.09
395 0.1
396 0.13
397 0.14